Recombinant Human APP protein, GST-tagged
| Cat.No. : | APP-7854H |
| Product Overview : | Recombinant Human APP protein(673-714 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Tag : | GST |
| Protein Length : | 673-714 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | AEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHH |
| Gene Name | APP amyloid beta (A4) precursor protein [ Homo sapiens ] |
| Official Symbol | APP |
| Synonyms | APP; amyloid beta (A4) precursor protein; AD1, Alzheimer disease; amyloid beta A4 protein; peptidase nexin II; preA4; protease nexin-II; peptidase nexin-II; beta-amyloid peptide; alzheimer disease amyloid protein; cerebral vascular amyloid peptide; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; CTFgamma; |
| Gene ID | 351 |
| mRNA Refseq | NM_000484 |
| Protein Refseq | NP_000475 |
| MIM | 104760 |
| UniProt ID | P05067 |
| ◆ Recombinant Proteins | ||
| APP-244H | Recombinant Human APP protein, MYC/DDK-tagged | +Inquiry |
| APP-192H | Active Recombinant Human APP protein, His & GST-tagged | +Inquiry |
| APP-6866H | Recombinant Human Amyloid Beta(A4) Precursor Protein, GST-tagged and His-tagged | +Inquiry |
| App-232R | Recombinant Rat App Protein, His&GST-tagged | +Inquiry |
| APP-1850H | Recombinant Human APP protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APP-3087HCL | Recombinant Human APP cell lysate | +Inquiry |
| APP-045HKCL | Human APP Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APP Products
Required fields are marked with *
My Review for All APP Products
Required fields are marked with *
