Recombinant Human APP protein, GST-tagged
Cat.No. : | APP-7854H |
Product Overview : | Recombinant Human APP protein(673-714 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | GST |
Protein Length : | 673-714 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | AEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHH |
Gene Name | APP amyloid beta (A4) precursor protein [ Homo sapiens ] |
Official Symbol | APP |
Synonyms | APP; amyloid beta (A4) precursor protein; AD1, Alzheimer disease; amyloid beta A4 protein; peptidase nexin II; preA4; protease nexin-II; peptidase nexin-II; beta-amyloid peptide; alzheimer disease amyloid protein; cerebral vascular amyloid peptide; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; CTFgamma; |
Gene ID | 351 |
mRNA Refseq | NM_000484 |
Protein Refseq | NP_000475 |
MIM | 104760 |
UniProt ID | P05067 |
◆ Recombinant Proteins | ||
APP-643M | Recombinant Mouse APP Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL-14031TF | Recombinant Full Length Tetraodon Fluviatilis Amyloid Beta A4 Protein(App) Protein, His-Tagged | +Inquiry |
APP-231H | Recombinant Human APP Protein, His-tagged | +Inquiry |
APP-2746H | Recombinant Human APP Protein, His&SUMO-tagged | +Inquiry |
APP-230H | Recombinant Human APP Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APP-3087HCL | Recombinant Human APP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APP Products
Required fields are marked with *
My Review for All APP Products
Required fields are marked with *
0
Inquiry Basket