Recombinant Human AR protein, His-tagged
Cat.No. : | AR-993H |
Product Overview : | Recombinant Human AR protein(P10275)(559-671aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 559-671aa |
Tag : | N-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
Molecular Mass : | 18.6kDa |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | TCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQ |
Gene Name | AR androgen receptor [ Homo sapiens ] |
Official Symbol | AR |
Synonyms | AR; androgen receptor; DHTR, dihydrotestosterone receptor , SBMA, spinal and bulbar muscular atrophy; AIS; HUMARA; Kennedy disease; NR3C4; SMAX1; testicular feminization; dihydrotestosterone receptor; androgen nuclear receptor variant 2; nuclear receptor subfamily 3 group C member 4; KD; TFM; DHTR; SBMA; HYSP1; |
Gene ID | 367 |
mRNA Refseq | NM_000044 |
Protein Refseq | NP_000035 |
MIM | 313700 |
UniProt ID | P10275 |
◆ Recombinant Proteins | ||
AR-2622H | Recombinant Human Androgen Receptor, His-tagged | +Inquiry |
AR-3407C | Recombinant Chicken AR | +Inquiry |
AR-993H | Recombinant Human AR protein, His-tagged | +Inquiry |
AR-003H | Recombinant Human AR Protein, Sumo/His/Strep-tagged | +Inquiry |
AR-8486H | Recombinant Human AR, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AR-8764HCL | Recombinant Human AR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AR Products
Required fields are marked with *
My Review for All AR Products
Required fields are marked with *