Recombinant Human AR protein, His-tagged
| Cat.No. : | AR-993H |
| Product Overview : | Recombinant Human AR protein(P10275)(559-671aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 559-671aa |
| Tag : | N-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Molecular Mass : | 18.6kDa |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | TCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQ |
| Gene Name | AR androgen receptor [ Homo sapiens ] |
| Official Symbol | AR |
| Synonyms | AR; androgen receptor; DHTR, dihydrotestosterone receptor , SBMA, spinal and bulbar muscular atrophy; AIS; HUMARA; Kennedy disease; NR3C4; SMAX1; testicular feminization; dihydrotestosterone receptor; androgen nuclear receptor variant 2; nuclear receptor subfamily 3 group C member 4; KD; TFM; DHTR; SBMA; HYSP1; |
| Gene ID | 367 |
| mRNA Refseq | NM_000044 |
| Protein Refseq | NP_000035 |
| MIM | 313700 |
| UniProt ID | P10275 |
| ◆ Recombinant Proteins | ||
| AR-375R | Recombinant Rhesus monkey AR Protein, His-tagged | +Inquiry |
| AR-743R | Recombinant Rat AR Protein, His tagged | +Inquiry |
| AR-1012H | Recombinant Human AR, His-tagged | +Inquiry |
| AR-8486H | Recombinant Human AR, Flag-tagged | +Inquiry |
| Ar-3451M | Recombinant Mouse Ar, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AR-8764HCL | Recombinant Human AR 293 Cell Lysate | +Inquiry |
| AR-047HKCL | Human AR Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AR Products
Required fields are marked with *
My Review for All AR Products
Required fields are marked with *
