Recombinant Human ARF4L protein, GST-tagged

Cat.No. : ARF4L-747H
Product Overview : Human ARF4L partial ORF ( AAH00043, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS). [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL4D ADP ribosylation factor like GTPase 4D [ Homo sapiens (human) ]
Official Symbol ARL4D
Synonyms ARL4D; ADP ribosylation factor like GTPase 4D; ARL6; ARF4L; ADP-ribosylation factor-like protein 4D; ADP-ribosylation factor-like 4D; ADP-ribosylation factor-like 6; ADP-ribosylation factor-like protein 4L
Gene ID 379
mRNA Refseq NM_001661
Protein Refseq NP_001652
MIM 600732
UniProt ID P49703

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL4D Products

Required fields are marked with *

My Review for All ARL4D Products

Required fields are marked with *

0
cart-icon