Recombinant Human ARF4L protein, GST-tagged
| Cat.No. : | ARF4L-747H |
| Product Overview : | Human ARF4L partial ORF ( AAH00043, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS). [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFV |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARL4D ADP ribosylation factor like GTPase 4D [ Homo sapiens (human) ] |
| Official Symbol | ARL4D |
| Synonyms | ARL4D; ADP ribosylation factor like GTPase 4D; ARL6; ARF4L; ADP-ribosylation factor-like protein 4D; ADP-ribosylation factor-like 4D; ADP-ribosylation factor-like 6; ADP-ribosylation factor-like protein 4L |
| Gene ID | 379 |
| mRNA Refseq | NM_001661 |
| Protein Refseq | NP_001652 |
| MIM | 600732 |
| UniProt ID | P49703 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL4D Products
Required fields are marked with *
My Review for All ARL4D Products
Required fields are marked with *
