Recombinant Human ARGLU1 protein, GST-tagged
| Cat.No. : | ARGLU1-301646H |
| Product Overview : | Recombinant Human ARGLU1 (63-191 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Thr63-Glu191 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
| AA Sequence : | TAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKARE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | ARGLU1 arginine and glutamate rich 1 [ Homo sapiens (human) |
| Official Symbol | ARGLU1 |
| Gene ID | 55082 |
| mRNA Refseq | NM_018011 |
| Protein Refseq | NP_060481 |
| MIM | 614046 |
| UniProt ID | Q9NWB6 |
| ◆ Recombinant Proteins | ||
| ARGLU1-1414C | Recombinant Chicken ARGLU1 | +Inquiry |
| ARGLU1-7843H | Recombinant Human ARGLU1 protein, His-tagged | +Inquiry |
| ARGLU1-386R | Recombinant Rhesus monkey ARGLU1 Protein, His-tagged | +Inquiry |
| ARGLU1-759H | Recombinant Human ARGLU1 protein, GST-tagged | +Inquiry |
| ARGLU1-761R | Recombinant Rat ARGLU1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARGLU1-8746HCL | Recombinant Human ARGLU1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARGLU1 Products
Required fields are marked with *
My Review for All ARGLU1 Products
Required fields are marked with *
