Recombinant Human ARHGAP24 protein, GST-tagged

Cat.No. : ARHGAP24-765H
Product Overview : Human ARHGAP24 full-length ORF ( NP_001036134.1, 1 a.a. - 653 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a Rho-GTPase activating protein, which is specific for the small GTPase family member Rac. Binding of the encoded protein by filamin A targets it to sites of membrane protrusion, where it antognizes Rac. This results in suppression of lamellae formation and promotion of retraction to regulate cell polarity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]
Molecular Mass : 99.7 kDa
AA Sequence : MTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARHGAP24 Rho GTPase activating protein 24 [ Homo sapiens ]
Official Symbol ARHGAP24
Synonyms ARHGAP24; Rho GTPase activating protein 24; rho GTPase-activating protein 24; DKFZP564B1162; FilGAP; FLJ33877; rhoGAP of 73 kDa; sarcoma antigen NY-SAR-88; filamin-A-associated RhoGAP; rho-type GTPase-activating protein 24; RAC1- and CDC42-specific GTPase-activating protein of 72 kDa; p73; FILGAP; RCGAP72; RC-GAP72; p73RhoGAP; DKFZp564B1162;
Gene ID 83478
mRNA Refseq NM_001025616
Protein Refseq NP_001020787
MIM 610586
UniProt ID Q8N264

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGAP24 Products

Required fields are marked with *

My Review for All ARHGAP24 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon