Recombinant Human ARHGAP24 protein, GST-tagged
Cat.No. : | ARHGAP24-765H |
Product Overview : | Human ARHGAP24 full-length ORF ( NP_001036134.1, 1 a.a. - 653 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a Rho-GTPase activating protein, which is specific for the small GTPase family member Rac. Binding of the encoded protein by filamin A targets it to sites of membrane protrusion, where it antognizes Rac. This results in suppression of lamellae formation and promotion of retraction to regulate cell polarity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 99.7 kDa |
AA Sequence : | MTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARHGAP24 Rho GTPase activating protein 24 [ Homo sapiens ] |
Official Symbol | ARHGAP24 |
Synonyms | ARHGAP24; Rho GTPase activating protein 24; rho GTPase-activating protein 24; DKFZP564B1162; FilGAP; FLJ33877; rhoGAP of 73 kDa; sarcoma antigen NY-SAR-88; filamin-A-associated RhoGAP; rho-type GTPase-activating protein 24; RAC1- and CDC42-specific GTPase-activating protein of 72 kDa; p73; FILGAP; RCGAP72; RC-GAP72; p73RhoGAP; DKFZp564B1162; |
Gene ID | 83478 |
mRNA Refseq | NM_001025616 |
Protein Refseq | NP_001020787 |
MIM | 610586 |
UniProt ID | Q8N264 |
◆ Recombinant Proteins | ||
Arhgap24-1682M | Recombinant Mouse Arhgap24 Protein, Myc/DDK-tagged | +Inquiry |
ARHGAP24-2581H | Recombinant Human ARHGAP24 Protein, His-tagged | +Inquiry |
ARHGAP24-3271H | Recombinant Human ARHGAP24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARHGAP24-765H | Recombinant Human ARHGAP24 protein, GST-tagged | +Inquiry |
ARHGAP24-765R | Recombinant Rat ARHGAP24 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGAP24-110HCL | Recombinant Human ARHGAP24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGAP24 Products
Required fields are marked with *
My Review for All ARHGAP24 Products
Required fields are marked with *
0
Inquiry Basket