Recombinant Human ARHGAP25 protein, GST-tagged
Cat.No. : | ARHGAP25-766H |
Product Overview : | Human ARHGAP25 full-length ORF ( AAH39591.1, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 78.2 kDa |
AA Sequence : | MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMVRCREPSCFHWVLPLVQAIPCKACSRVAIWGVLGDAVAVGAAATDSSEHTLKAWPLSKSSFYWHL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARHGAP25 Rho GTPase activating protein 25 [ Homo sapiens ] |
Official Symbol | ARHGAP25 |
Synonyms | ARHGAP25; Rho GTPase activating protein 25; rho GTPase-activating protein 25; KIAA0053; rho-type GTPase-activating protein 25; KAIA0053; |
Gene ID | 9938 |
mRNA Refseq | NM_001007231 |
Protein Refseq | NP_001007232 |
MIM | 610587 |
UniProt ID | P42331 |
◆ Recombinant Proteins | ||
ARHGAP25-0539H | Recombinant Human ARHGAP25 Protein (Met1-Leu458), C-His-tagged | +Inquiry |
ARHGAP25-1864M | Recombinant Mouse ARHGAP25 Protein | +Inquiry |
ARHGAP25-3411H | Recombinant Human ARHGAP25 protein, His-tagged | +Inquiry |
ARHGAP25-2574C | Recombinant Chicken ARHGAP25 | +Inquiry |
ARHGAP25-945H | Recombinant Human ARHGAP25 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGAP25-8741HCL | Recombinant Human ARHGAP25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGAP25 Products
Required fields are marked with *
My Review for All ARHGAP25 Products
Required fields are marked with *
0
Inquiry Basket