Recombinant Human ARHGAP25 protein, GST-tagged
| Cat.No. : | ARHGAP25-766H |
| Product Overview : | Human ARHGAP25 full-length ORF ( AAH39591.1, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM, Mar 2008] |
| Molecular Mass : | 78.2 kDa |
| AA Sequence : | MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMVRCREPSCFHWVLPLVQAIPCKACSRVAIWGVLGDAVAVGAAATDSSEHTLKAWPLSKSSFYWHL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARHGAP25 Rho GTPase activating protein 25 [ Homo sapiens ] |
| Official Symbol | ARHGAP25 |
| Synonyms | ARHGAP25; Rho GTPase activating protein 25; rho GTPase-activating protein 25; KIAA0053; rho-type GTPase-activating protein 25; KAIA0053; |
| Gene ID | 9938 |
| mRNA Refseq | NM_001007231 |
| Protein Refseq | NP_001007232 |
| MIM | 610587 |
| UniProt ID | P42331 |
| ◆ Recombinant Proteins | ||
| ARHGAP25-1864M | Recombinant Mouse ARHGAP25 Protein | +Inquiry |
| ARHGAP25-945H | Recombinant Human ARHGAP25 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ARHGAP25-1094HF | Recombinant Full Length Human ARHGAP25 Protein, GST-tagged | +Inquiry |
| ARHGAP25-392R | Recombinant Rhesus monkey ARHGAP25 Protein, His-tagged | +Inquiry |
| ARHGAP25-766H | Recombinant Human ARHGAP25 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGAP25-8741HCL | Recombinant Human ARHGAP25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGAP25 Products
Required fields are marked with *
My Review for All ARHGAP25 Products
Required fields are marked with *



