Recombinant Human ARHGAP28 protein, His-tagged
Cat.No. : | ARHGAP28-2950H |
Product Overview : | Recombinant Human ARHGAP28 protein(1-167 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-167 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MNELPRDTCGNHTNQLDGTKEERELPRVIKTSGSMPDDASLNSTTLSDASQDKEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNIPPEAEELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVLTKFNVQKTRFGLTEAGDLSAEDMKKIR |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ARHGAP28 Rho GTPase activating protein 28 [ Homo sapiens ] |
Official Symbol | ARHGAP28 |
Synonyms | ARHGAP28; Rho GTPase activating protein 28; rho GTPase-activating protein 28; FLJ10312; KIAA1314; rho-type GTPase-activating protein 28; FLJ27160; DKFZp686A2038; |
Gene ID | 79822 |
mRNA Refseq | NM_001010000 |
Protein Refseq | NP_001010000 |
MIM | 610592 |
UniProt ID | Q9P2N2 |
◆ Recombinant Proteins | ||
ARHGAP28-677M | Recombinant Mouse ARHGAP28 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGAP28-768H | Recombinant Human ARHGAP28 protein, GST-tagged | +Inquiry |
ARHGAP28-1323HF | Recombinant Full Length Human ARHGAP28 Protein, GST-tagged | +Inquiry |
ARHGAP28-1813Z | Recombinant Zebrafish ARHGAP28 | +Inquiry |
ARHGAP28-1867M | Recombinant Mouse ARHGAP28 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGAP28-112HCL | Recombinant Human ARHGAP28 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGAP28 Products
Required fields are marked with *
My Review for All ARHGAP28 Products
Required fields are marked with *
0
Inquiry Basket