Recombinant Human ARHGAP4 Protein, His-tagged

• Cat.No.: ARHGAP4-27H
• Product Overview: Recombinant Human ARHGAP4 Protein(P98171)(341-420 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 341-420 aa
• Form: Phosphate buffered saline
• Molecular Mass: 11 kDa
• AASequence: DGDEVAEICVEMELRDEILPRAQNIQSRLDRQTIETEEVNKTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSD
• Storage: Store at -20°C to -80°C.
• Concentration: 0.1-1.0 mg/ml

Gene Information

• Gene Name: ARHGAP4 Rho GTPase activating protein 4 [ Homo sapiens ]
• Official Symbol: ARHGAP4
• Synonyms: ARHGAP4; Rho GTPase activating protein 4; rho GTPase-activating protein 4; C1; KIAA0131; p115; Rho GAP hematopoietic protein C1; RhoGAP4; SrGAP4; Rho-GAP hematopoietic protein C1; rho-type GTPase-activating protein 4; RGC1
• Gene ID: 393
• mRNA Refseq: NM_001164741
• Protein Refseq: NP_001158213
• MIM: 300023
• UniProt ID: P98171