Recombinant Human ARHGAP45 Protein, GST-tagged

• Cat.No.: ARHGAP45-4883H
• Product Overview: Human HMHA1 partial ORF ( AAH65223.1, 91 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ARHGAP45 (Rho GTPase Activating Protein 45) is a Protein Coding gene. Among its related pathways are Innate Immune System and Signaling by GPCR. An important paralog of this gene is ARHGAP29.
• Molecular Mass: 36.74 kDa
• AA Sequence: HRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLHDDLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARHGAP45 Rho GTPase activating protein 45 [ Homo sapiens (human) ]
• Official Symbol: ARHGAP45
• Synonyms: ARHGAP45; Rho GTPase activating protein 45; HMHA1; histocompatibility (minor) HA-1; minor histocompatibility protein HA-1; ARHGAP45; HA 1; KIAA0223; minor histocompatibility antigen HA-1; HA-1; HLA-HA1
• Gene ID: 23526
• mRNA Refseq: NM_001258328
• Protein Refseq: NP_001245257
• MIM: 601155
• UniProt ID: Q92619