Recombinant Human ARHGAP45 Protein, GST-tagged
| Cat.No. : | ARHGAP45-4883H |
| Product Overview : | Human HMHA1 partial ORF ( AAH65223.1, 91 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ARHGAP45 (Rho GTPase Activating Protein 45) is a Protein Coding gene. Among its related pathways are Innate Immune System and Signaling by GPCR. An important paralog of this gene is ARHGAP29. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | HRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLHDDLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARHGAP45 Rho GTPase activating protein 45 [ Homo sapiens (human) ] |
| Official Symbol | ARHGAP45 |
| Synonyms | ARHGAP45; Rho GTPase activating protein 45; HMHA1; histocompatibility (minor) HA-1; minor histocompatibility protein HA-1; ARHGAP45; HA 1; KIAA0223; minor histocompatibility antigen HA-1; HA-1; HLA-HA1; |
| Gene ID | 23526 |
| mRNA Refseq | NM_001258328 |
| Protein Refseq | NP_001245257 |
| MIM | 601155 |
| UniProt ID | Q92619 |
| ◆ Recombinant Proteins | ||
| Arhgap45-1687M | Recombinant Mouse Arhgap45 Protein, Myc/DDK-tagged | +Inquiry |
| ARHGAP45-2700H | Recombinant Human ARHGAP45 Protein, MYC/DDK-tagged | +Inquiry |
| ARHGAP45-1740H | Recombinant Human ARHGAP45 protein, His & T7-tagged | +Inquiry |
| ARHGAP45-2547H | Recombinant Human ARHGAP45 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ARHGAP45-4883H | Recombinant Human ARHGAP45 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGAP45 Products
Required fields are marked with *
My Review for All ARHGAP45 Products
Required fields are marked with *
