Recombinant Human ARHGDIB protein, GST-tagged
| Cat.No. : | ARHGDIB-29H |
| Product Overview : | Recombinant Human ARHGDIB protein(1-201 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-201 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ARHGDIB Rho GDP dissociation inhibitor (GDI) beta [ Homo sapiens ] |
| Official Symbol | ARHGDIB |
| Synonyms | ARHGDIB; Rho GDP dissociation inhibitor (GDI) beta; GDIA2, GDID4, RAP1GN1; rho GDP-dissociation inhibitor 2; Ly GDI; RhoGDI2; Rho GDI 2; rho-GDI beta; D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; |
| Gene ID | 397 |
| mRNA Refseq | NM_001175 |
| Protein Refseq | NP_001166 |
| MIM | 602843 |
| UniProt ID | P52566 |
| ◆ Recombinant Proteins | ||
| ARHGDIB-29H | Recombinant Human ARHGDIB protein, GST-tagged | +Inquiry |
| ARHGDIB-9829H | Recombinant Human ARHGDIB, GST-tagged | +Inquiry |
| ARHGDIB-27088TH | Recombinant Human ARHGDIB, GST-tagged | +Inquiry |
| ARHGDIB-775H | Recombinant Human ARHGDIB protein, GST-tagged | +Inquiry |
| ARHGDIB-63HFL | Recombinant Full Length Human ARHGDIB Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGDIB-8735HCL | Recombinant Human ARHGDIB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGDIB Products
Required fields are marked with *
My Review for All ARHGDIB Products
Required fields are marked with *


