Recombinant Human ARHGEF18 protein, GST-tagged

Cat.No. : ARHGEF18-783H
Product Overview : Human ARHGEF18 full-length ORF ( AAH08016.1, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008]
Molecular Mass : 35.8 kDa
AA Sequence : MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARHGEF18 Rho/Rac guanine nucleotide exchange factor (GEF) 18 [ Homo sapiens ]
Official Symbol ARHGEF18
Synonyms ARHGEF18; Rho/Rac guanine nucleotide exchange factor (GEF) 18; rho/rac guanine nucleotide exchange factor (GEF) 18; rho guanine nucleotide exchange factor 18; KIAA0521; MGC15913; P114 RhoGEF; Rho specific guanine nucleotide exchange factor p114; SA-RhoGEF; p114RhoGEF; P114-RHO-GEF; septin-associated RhoGEF; Rho/Rac guanine nucleotide exchange factor 18; Rho-specific guanine nucleotide exchange factor p114; 114 kDa Rho-specific guanine nucleotide exchange factor; P114-RhoGEF;
Gene ID 23370
mRNA Refseq NM_001130955
Protein Refseq NP_001124427
UniProt ID Q6ZSZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGEF18 Products

Required fields are marked with *

My Review for All ARHGEF18 Products

Required fields are marked with *

0
cart-icon
0
compare icon