Recombinant Human ARL11 protein, GST-tagged
| Cat.No. : | ARL11-804H |
| Product Overview : | Human ARL11 full-length ORF ( NP_612459.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers. [provided by RefSeq, May 2010] |
| Molecular Mass : | 47.8 kDa |
| AA Sequence : | MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARL11 ADP-ribosylation factor-like 11 [ Homo sapiens ] |
| Official Symbol | ARL11 |
| Synonyms | ARL11; ADP-ribosylation factor-like 11; ADP-ribosylation factor-like protein 11; ARLTS1; FLJ33930; ADP-ribosylation factor-like tumor suppressor protein 1; MGC17429; |
| Gene ID | 115761 |
| mRNA Refseq | NM_138450 |
| Protein Refseq | NP_612459 |
| MIM | 609351 |
| UniProt ID | Q969Q4 |
| ◆ Recombinant Proteins | ||
| ARL11-10091Z | Recombinant Zebrafish ARL11 | +Inquiry |
| ARL11-777R | Recombinant Rat ARL11 Protein | +Inquiry |
| ARL11-3557H | Recombinant Human ARL11, His-tagged | +Inquiry |
| ARL11-9849H | Recombinant Human ARL11, GST-tagged | +Inquiry |
| ARL11-1513HF | Recombinant Full Length Human ARL11 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL11-8722HCL | Recombinant Human ARL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL11 Products
Required fields are marked with *
My Review for All ARL11 Products
Required fields are marked with *
