Recombinant Human ARL16 protein, His-tagged
| Cat.No. : | ARL16-6888H |
| Product Overview : | Recombinant Human ARL16 protein(1-197 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1-197 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MRVAGGRALSRGAELRVPGGAKHGMCLLLGATGVGKTLLVKRLQEVSSRDGKGDLGEPPPTRPTVGTNLTDIVAQRKITIRELGGCMGPIWSSYYGNCRSLLFVMDASDPTQLSASCVQLLGLLSAEQLAEASVLILFNKIDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | ARL16 ADP-ribosylation factor-like 16 [ Homo sapiens ] |
| Official Symbol | ARL16 |
| Synonyms | ARL16; ADP-ribosylation factor-like 16; ADP-ribosylation factor-like protein 16; |
| mRNA Refseq | NM_001040025 |
| Protein Refseq | NP_001035114 |
| UniProt ID | Q0P5N6 |
| Gene ID | 339231 |
| ◆ Recombinant Proteins | ||
| ARL16-5598Z | Recombinant Zebrafish ARL16 | +Inquiry |
| ARL16-6887H | Recombinant Human ARL16 protein, GST-tagged | +Inquiry |
| ARL16-807H | Recombinant Human ARL16 protein, GST-tagged | +Inquiry |
| ARL16-6888H | Recombinant Human ARL16 protein, His-tagged | +Inquiry |
| ARL16-1449HF | Recombinant Full Length Human ARL16 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL16-8717HCL | Recombinant Human ARL16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL16 Products
Required fields are marked with *
My Review for All ARL16 Products
Required fields are marked with *
