Recombinant Human ARL3 protein, GST-tagged

Cat.No. : ARL3-810H
Product Overview : Human ARL3 full-length ORF ( AAH09841, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. [provided by RefSeq, Jul 2008]
Molecular Mass : 45.76 kDa
AA Sequence : MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL3 ADP-ribosylation factor-like 3 [ Homo sapiens ]
Official Symbol ARL3
Synonyms ARL3; ADP-ribosylation factor-like 3; ADP-ribosylation factor-like protein 3; ARFL3; ARF-like 3;
Gene ID 403
mRNA Refseq NM_004311
Protein Refseq NP_004302
MIM 604695
UniProt ID P36405

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL3 Products

Required fields are marked with *

My Review for All ARL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon