Recombinant Human ARL4A protein, GST-tagged
Cat.No. : | ARL4A-811H |
Product Overview : | Human ARL4A full-length ORF ( AAH01111, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ADP-ribosylation factor-like 4A is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4A is similar to ARL4C and ARL4D and each has a nuclear localization signal and an unusually high guaninine nucleotide exchange rate. ARL4A is located in both the nuclear and extranuclear cell compartments. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 47.74 kDa |
AA Sequence : | MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL4A ADP-ribosylation factor-like 4A [ Homo sapiens ] |
Official Symbol | ARL4A |
Synonyms | ARL4A; ADP-ribosylation factor-like 4A; ADP ribosylation factor like 4 , ARL4; ADP-ribosylation factor-like protein 4A; ADP-ribosylation factor-like 4; ARL4; |
Gene ID | 10124 |
mRNA Refseq | NM_001037164 |
Protein Refseq | NP_001032241 |
MIM | 604786 |
UniProt ID | P40617 |
◆ Recombinant Proteins | ||
ARL4A-401R | Recombinant Rhesus monkey ARL4A Protein, His-tagged | +Inquiry |
ARL4A-230R | Recombinant Rhesus Macaque ARL4A Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL4A-193H | Recombinant Human ARL4A protein, T7-tagged | +Inquiry |
ARL4A-783R | Recombinant Rat ARL4A Protein | +Inquiry |
ARL4A-811H | Recombinant Human ARL4A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL4A-8713HCL | Recombinant Human ARL4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL4A Products
Required fields are marked with *
My Review for All ARL4A Products
Required fields are marked with *