Recombinant Human ARL6IP protein, GST-tagged

Cat.No. : ARL6IP-817H
Product Overview : Human ARL6IP full-length ORF ( AAH10281, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2015]
Molecular Mass : 48.07 kDa
AA Sequence : MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL6IP1 ADP ribosylation factor like GTPase 6 interacting protein 1 [ Homo sapiens (human) ]
Official Symbol ARL6IP1
Synonyms ARL6IP1; ADP ribosylation factor like GTPase 6 interacting protein 1; AIP1; ARMER; SPG61; ARL6IP; ADP-ribosylation factor-like protein 6-interacting protein 1; ADP-ribosylation factor GTPase 6 interacting protein 1; ADP-ribosylation factor-like 6 interacting protein 1; ARL-6-interacting protein 1; aip-1; apoptotic regulator in the membrane of the endoplasmic reticulum
Gene ID 23204
mRNA Refseq NM_001313858
Protein Refseq NP_001300787
MIM 607669
UniProt ID Q15041

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL6IP1 Products

Required fields are marked with *

My Review for All ARL6IP1 Products

Required fields are marked with *

0
cart-icon