Recombinant Human ARL6IP protein, GST-tagged
Cat.No. : | ARL6IP-817H |
Product Overview : | Human ARL6IP full-length ORF ( AAH10281, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2015] |
Molecular Mass : | 48.07 kDa |
AA Sequence : | MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL6IP1 ADP ribosylation factor like GTPase 6 interacting protein 1 [ Homo sapiens (human) ] |
Official Symbol | ARL6IP1 |
Synonyms | ARL6IP1; ADP ribosylation factor like GTPase 6 interacting protein 1; AIP1; ARMER; SPG61; ARL6IP; ADP-ribosylation factor-like protein 6-interacting protein 1; ADP-ribosylation factor GTPase 6 interacting protein 1; ADP-ribosylation factor-like 6 interacting protein 1; ARL-6-interacting protein 1; aip-1; apoptotic regulator in the membrane of the endoplasmic reticulum |
Gene ID | 23204 |
mRNA Refseq | NM_001313858 |
Protein Refseq | NP_001300787 |
MIM | 607669 |
UniProt ID | Q15041 |
◆ Recombinant Proteins | ||
ARL6IP1-9861H | Recombinant Human ARL6IP1, GST-tagged | +Inquiry |
ARL6IP-817H | Recombinant Human ARL6IP protein, GST-tagged | +Inquiry |
ARL6IP1-378H | Recombinant Human ARL6IP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL6IP1-2043HFL | Recombinant Full Length Human ARL6IP1 Protein, C-Flag-tagged | +Inquiry |
RFL30480HF | Recombinant Full Length Human Adp-Ribosylation Factor-Like Protein 6-Interacting Protein 1(Arl6Ip1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL6IP1-8707HCL | Recombinant Human ARL6IP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL6IP1 Products
Required fields are marked with *
My Review for All ARL6IP1 Products
Required fields are marked with *
0
Inquiry Basket