Recombinant Human ARL6IP6 protein, GST-tagged

Cat.No. : ARL6IP6-821H
Product Overview : Human ARL6IP6 full-length ORF ( NP_689735.1, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ARL6IP6 (ADP Ribosylation Factor Like GTPase 6 Interacting Protein 6) is a Protein Coding gene. Diseases associated with ARL6IP6 include Cutis Marmorata Telangiectatica Congenita.
Molecular Mass : 51.1 kDa
AA Sequence : MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLSILCSLLFAILLAFLLAIAYLIVKELHAENLKNEDDVDTGLLGFWTLLIISLTAGFSCCSFSWTVTYFDSFEPGMFPPTPLSPARFKKLTGHSFHMGYSMAILNGIVAALTVAWCLM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL6IP6 ADP-ribosylation-like factor 6 interacting protein 6 [ Homo sapiens ]
Official Symbol ARL6IP6
Synonyms ADP ribosylation like factor 6 interacting protein 6; ADP-ribosylation factor-like protein 6-interacting protein 6; Aip-6; AR6P6_HUMAN; ARL-6-interacting protein 6; ARL6IP6; PFAAP1; Phosphonoformate immuno-associated protein 1; Regulated by phosphonoformate; ARL6IP6
Gene ID 151188
mRNA Refseq NM_152522.5
Protein Refseq NP_689735.1
UniProt ID B3KMZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL6IP6 Products

Required fields are marked with *

My Review for All ARL6IP6 Products

Required fields are marked with *

0
cart-icon