Recombinant Human ARL6IP6 protein, GST-tagged
| Cat.No. : | ARL6IP6-821H |
| Product Overview : | Human ARL6IP6 full-length ORF ( NP_689735.1, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ARL6IP6 (ADP Ribosylation Factor Like GTPase 6 Interacting Protein 6) is a Protein Coding gene. Diseases associated with ARL6IP6 include Cutis Marmorata Telangiectatica Congenita. |
| Molecular Mass : | 51.1 kDa |
| AA Sequence : | MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLSILCSLLFAILLAFLLAIAYLIVKELHAENLKNEDDVDTGLLGFWTLLIISLTAGFSCCSFSWTVTYFDSFEPGMFPPTPLSPARFKKLTGHSFHMGYSMAILNGIVAALTVAWCLM |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARL6IP6 ADP-ribosylation-like factor 6 interacting protein 6 [ Homo sapiens ] |
| Official Symbol | ARL6IP6 |
| Synonyms | ADP ribosylation like factor 6 interacting protein 6; ADP-ribosylation factor-like protein 6-interacting protein 6; Aip-6; AR6P6_HUMAN; ARL-6-interacting protein 6; ARL6IP6; PFAAP1; Phosphonoformate immuno-associated protein 1; Regulated by phosphonoformate; ARL6IP6 |
| Gene ID | 151188 |
| mRNA Refseq | NM_152522.5 |
| Protein Refseq | NP_689735.1 |
| UniProt ID | B3KMZ5 |
| ◆ Cell & Tissue Lysates | ||
| ARL6IP6-8706HCL | Recombinant Human ARL6IP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL6IP6 Products
Required fields are marked with *
My Review for All ARL6IP6 Products
Required fields are marked with *
