Recombinant Human ARMC8 protein, GST-tagged
| Cat.No. : | ARMC8-831H |
| Product Overview : | Human ARMC8 full-length ORF ( NP_054873.2, 1 a.a. - 385 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ARMC8 (Armadillo Repeat Containing 8) is a Protein Coding gene. Among its related pathways are Immune System. GO annotations related to this gene include binding. |
| Molecular Mass : | 69.4 kDa |
| AA Sequence : | MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARMC8 armadillo repeat containing 8 [ Homo sapiens ] |
| Official Symbol | ARMC8 |
| Synonyms | ARMC8; armadillo repeat containing 8; armadillo repeat-containing protein 8; DKFZP434A043; HSPC056; S863-2; MGC4880; MGC10058; |
| Gene ID | 25852 |
| mRNA Refseq | NM_014154 |
| Protein Refseq | NP_054873 |
| UniProt ID | Q8IUR7 |
| ◆ Recombinant Proteins | ||
| ARMC8-409R | Recombinant Rhesus monkey ARMC8 Protein, His-tagged | +Inquiry |
| ARMC8-1318H | Recombinant Human ARMC8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Armc8-1720M | Recombinant Mouse Armc8 Protein, Myc/DDK-tagged | +Inquiry |
| ARMC8-1177HF | Recombinant Full Length Human ARMC8 Protein, GST-tagged | +Inquiry |
| ARMC8-831H | Recombinant Human ARMC8 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARMC8-8699HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
| ARMC8-8698HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
| ARMC8-8697HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARMC8 Products
Required fields are marked with *
My Review for All ARMC8 Products
Required fields are marked with *
