Recombinant Human ARMC8 protein, GST-tagged

Cat.No. : ARMC8-831H
Product Overview : Human ARMC8 full-length ORF ( NP_054873.2, 1 a.a. - 385 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ARMC8 (Armadillo Repeat Containing 8) is a Protein Coding gene. Among its related pathways are Immune System. GO annotations related to this gene include binding.
Molecular Mass : 69.4 kDa
AA Sequence : MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARMC8 armadillo repeat containing 8 [ Homo sapiens ]
Official Symbol ARMC8
Synonyms ARMC8; armadillo repeat containing 8; armadillo repeat-containing protein 8; DKFZP434A043; HSPC056; S863-2; MGC4880; MGC10058;
Gene ID 25852
mRNA Refseq NM_014154
Protein Refseq NP_054873
UniProt ID Q8IUR7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARMC8 Products

Required fields are marked with *

My Review for All ARMC8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon