Recombinant Human ARMCX2 protein, GST-tagged

Cat.No. : ARMCX2-834H
Product Overview : Human ARMCX2 partial ORF ( NP_055597, 508 a.a. - 599 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein containing a potential N-terminal transmembrane domain and multiple armadillo (arm) repeats. Proteins containing arm repeats are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is located in a cluster of related genes on chromosome X. There is a pseudogene for this gene on chromosome 7. Alternative splicing in the 5' UTR results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2013]
Molecular Mass : 35.86 kDa
AA Sequence : NSIANFFRLLSQGGGKIKVEILKILSNFAENPDMLKKLLSTQVPASFSSLYNSYVESEILINALTLFEIIYDNLRAEVFNYREFNKGSLFYL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARMCX2 armadillo repeat containing, X-linked 2 [ Homo sapiens ]
Official Symbol ARMCX2
Synonyms armadillo repeat containing, X-linked 2; arm protein lost in epithelial cancers, X chromosome, 2; ALEX2; armadillo repeat protein ALEX2; KIAA0512; armadillo repeat-containing X-linked protein 2; ARM protein lost in epithelial cancers on chromosome X 2; Protein ALEX2
Gene ID 9823
mRNA Refseq NM_014782.5
Protein Refseq NP_055597.1
MIM 300363
UniProt ID Q7L311

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARMCX2 Products

Required fields are marked with *

My Review for All ARMCX2 Products

Required fields are marked with *

0
cart-icon
0
compare icon