Recombinant Human ARMCX2 protein, GST-tagged

• Cat.No.: ARMCX2-834H
• Product Overview: Human ARMCX2 partial ORF ( NP_055597, 508 a.a. - 599 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein containing a potential N-terminal transmembrane domain and multiple armadillo (arm) repeats. Proteins containing arm repeats are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is located in a cluster of related genes on chromosome X. There is a pseudogene for this gene on chromosome 7. Alternative splicing in the 5' UTR results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2013]
• Molecular Mass: 35.86 kDa
• AA Sequence: NSIANFFRLLSQGGGKIKVEILKILSNFAENPDMLKKLLSTQVPASFSSLYNSYVESEILINALTLFEIIYDNLRAEVFNYREFNKGSLFYL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARMCX2 armadillo repeat containing, X-linked 2 [ Homo sapiens ]
• Official Symbol: ARMCX2
• Synonyms: armadillo repeat containing, X-linked 2; arm protein lost in epithelial cancers, X chromosome, 2; ALEX2; armadillo repeat protein ALEX2; KIAA0512; armadillo repeat-containing X-linked protein 2; ARM protein lost in epithelial cancers on chromosome X 2; Protein ALEX2
• Gene ID: 9823
• mRNA Refseq: NM_014782.5
• Protein Refseq: NP_055597.1
• MIM: 300363
• UniProt ID: Q7L311