Recombinant Human ARNT, GST-tagged
| Cat.No. : | ARNT-20H |
| Product Overview : | Recombinant Human ARNT(1 a.a. - 789 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 113 kDa |
| AA Sequence : | MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFA RSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTST DGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQL STSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTF VDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPY SDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHS QVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSS FSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPA QQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Publications : |
| Gene Name | ARNT aryl hydrocarbon receptor nuclear translocator [ Homo sapiens (human) ] |
| Official Symbol | ARNT |
| Synonyms | ARNT; aryl hydrocarbon receptor nuclear translocator; bHLHe2; HIF 1beta; dioxin receptor, nuclear translocator; class E basic helix-loop-helix protein 2; hypoxia-inducible factor 1, beta subunit; HIF1B; TANGO; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta |
| Gene ID | 405 |
| mRNA Refseq | NM_001668 |
| Protein Refseq | NP_001659 |
| MIM | 126110 |
| UniProt ID | P27540 |
| Chromosome Location | 1q21 |
| Pathway | AhR pathway; Cellular response to hypoxia; Chemical carcinogenesis |
| Function | contributes_to RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity; aryl hydrocarbon receptor activity; aryl hydrocarbon receptor binding |
| ◆ Recombinant Proteins | ||
| ARNT-0377H | Recombinant Human ARNT Protein (Met1-Ser348), N-His-tagged | +Inquiry |
| ARNT-1433HFL | Recombinant Full Length Human ARNT, Flag-tagged | +Inquiry |
| ARNT-32H | Recombinant Human ARNT protein, His/S-tagged | +Inquiry |
| ARNT-1863Z | Recombinant Zebrafish ARNT | +Inquiry |
| arnT-01K | Recombinant Klebsiella pneumoniae (strain 342) arnT protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARNT-054HKCL | Human ARNT Knockdown Cell Lysate | +Inquiry |
| ARNT-8692HCL | Recombinant Human ARNT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARNT Products
Required fields are marked with *
My Review for All ARNT Products
Required fields are marked with *



