Recombinant Human ARTN protein, His-GST&Myc-tagged
Cat.No. : | ARTN-3567H |
Product Overview : | Recombinant Human ARTN protein(Q5T4W7)(108-220aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 108-220aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG |
Gene Name | ARTN artemin [ Homo sapiens ] |
Official Symbol | ARTN |
Synonyms | ARTN; artemin; ENOVIN; EVN; NBN; neublastin; neurotrophic factor; |
Gene ID | 9048 |
mRNA Refseq | NM_001136215 |
Protein Refseq | NP_001129687 |
MIM | 603886 |
UniProt ID | Q5T4W7 |
◆ Recombinant Proteins | ||
Artn-1692M | Recombinant Mouse Artn protein, His-tagged | +Inquiry |
Artn-2554R | Recombinant Rat Artn protein, His&Myc-tagged | +Inquiry |
ARTN-467R | Recombinant Rat ARTN Protein, His (Fc)-Avi-tagged | +Inquiry |
ARTN-12H | Recombinant Human Artemin | +Inquiry |
ARTN-811R | Recombinant Rat ARTN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARTN-134HCL | Recombinant Human ARTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARTN Products
Required fields are marked with *
My Review for All ARTN Products
Required fields are marked with *
0
Inquiry Basket