Recombinant Human ARTN protein, His-GST&Myc-tagged
| Cat.No. : | ARTN-3567H |
| Product Overview : | Recombinant Human ARTN protein(Q5T4W7)(108-220aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 108-220aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.1 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG |
| Gene Name | ARTN artemin [ Homo sapiens ] |
| Official Symbol | ARTN |
| Synonyms | ARTN; artemin; ENOVIN; EVN; NBN; neublastin; neurotrophic factor; |
| Gene ID | 9048 |
| mRNA Refseq | NM_001136215 |
| Protein Refseq | NP_001129687 |
| MIM | 603886 |
| UniProt ID | Q5T4W7 |
| ◆ Recombinant Proteins | ||
| ARTN-3567H | Recombinant Human ARTN protein, His-GST&Myc-tagged | +Inquiry |
| ARTN-5643H | Recombinant Human ARTN protein, hFc-tagged | +Inquiry |
| ARTN-006H | Active Recombinant Human ARTN Protein | +Inquiry |
| ARTN-811R | Recombinant Rat ARTN Protein | +Inquiry |
| Artn-578M | Active Recombinant Mouse Artemin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARTN-134HCL | Recombinant Human ARTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARTN Products
Required fields are marked with *
My Review for All ARTN Products
Required fields are marked with *



