Recombinant Human ARVCF protein, GST-tagged
Cat.No. : | ARVCF-875H |
Product Overview : | Human ARVCF partial ORF ( NP_001661, 863 a.a. - 962 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Armadillo Repeat gene deleted in Velo-Cardio-Facial syndrome (ARVCF) is a member of the catenin family. This family plays an important role in the formation of adherens junction complexes, which are thought to facilitate communication between the inside and outside environments of a cell. The ARVCF gene was isolated in the search for the genetic defect responsible for the autosomal dominant Velo-Cardio-Facial syndrome (VCFS), a relatively common human disorder with phenotypic features including cleft palate, conotruncal heart defects and facial dysmorphology. The ARVCF gene encodes a protein containing two motifs, a coiled coil domain in the N-terminus and a 10 armadillo repeat sequence in the midregion. Since these sequences can facilitate protein-protein interactions ARVCF is thought to function in a protein complex. In addition, ARVCF contains a predicted nuclear-targeting sequence suggesting that it may have a function as a nuclear protein. [provided by RefSeq, Jun 2010] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARVCF armadillo repeat gene deleted in velocardiofacial syndrome [ Homo sapiens ] |
Official Symbol | ARVCF |
Synonyms | ARVCF; armadillo repeat gene deleted in velocardiofacial syndrome; armadillo repeat protein deleted in velo-cardio-facial syndrome; FLJ35345; |
Gene ID | 421 |
mRNA Refseq | NM_001670 |
Protein Refseq | NP_001661 |
MIM | 602269 |
UniProt ID | O00192 |
◆ Recombinant Proteins | ||
ARVCF-301126H | Recombinant Human ARVCF protein, GST-tagged | +Inquiry |
Arvcf-3633M | Recombinant Mouse Arvcf, His-tagged | +Inquiry |
ARVCF-3632H | Recombinant Human ARVCF, His-tagged | +Inquiry |
ARVCF-6035C | Recombinant Chicken ARVCF | +Inquiry |
ARVCF-1995M | Recombinant Mouse ARVCF Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARVCF Products
Required fields are marked with *
My Review for All ARVCF Products
Required fields are marked with *
0
Inquiry Basket