Recombinant Human ARVCF protein, GST-tagged
| Cat.No. : | ARVCF-301126H |
| Product Overview : | Recombinant Human ARVCF protein(875-962 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 875-962 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | LVDKSLEGEKTGSRDVIPMDALGPDGYSTVDQRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ARVCF armadillo repeat gene deleted in velocardiofacial syndrome [ Homo sapiens ] |
| Official Symbol | ARVCF |
| Synonyms | ARVCF; armadillo repeat gene deleted in velocardiofacial syndrome; armadillo repeat protein deleted in velo-cardio-facial syndrome; FLJ35345; |
| Gene ID | 421 |
| mRNA Refseq | NM_001670 |
| Protein Refseq | NP_001661 |
| MIM | 602269 |
| UniProt ID | O00192 |
| ◆ Recombinant Proteins | ||
| Arvcf-3633M | Recombinant Mouse Arvcf, His-tagged | +Inquiry |
| ARVCF-1995M | Recombinant Mouse ARVCF Protein | +Inquiry |
| ARVCF-3632H | Recombinant Human ARVCF, His-tagged | +Inquiry |
| ARVCF-6035C | Recombinant Chicken ARVCF | +Inquiry |
| ARVCF-301126H | Recombinant Human ARVCF protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARVCF Products
Required fields are marked with *
My Review for All ARVCF Products
Required fields are marked with *
