Recombinant Human ARVCF protein, GST-tagged

Cat.No. : ARVCF-301126H
Product Overview : Recombinant Human ARVCF (875-962 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Leu875-Val962
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : LVDKSLEGEKTGSRDVIPMDALGPDGYSTVDQRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name ARVCF armadillo repeat gene deleted in velocardiofacial syndrome [ Homo sapiens ]
Official Symbol ARVCF
Synonyms ARVCF; armadillo repeat gene deleted in velocardiofacial syndrome; armadillo repeat protein deleted in velo-cardio-facial syndrome; FLJ35345;
Gene ID 421
mRNA Refseq NM_001670
Protein Refseq NP_001661
MIM 602269
UniProt ID O00192

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARVCF Products

Required fields are marked with *

My Review for All ARVCF Products

Required fields are marked with *

0
cart-icon