Recombinant Human ARVCF protein, GST-tagged
| Cat.No. : | ARVCF-301126H |
| Product Overview : | Recombinant Human ARVCF (875-962 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Leu875-Val962 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | LVDKSLEGEKTGSRDVIPMDALGPDGYSTVDQRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | ARVCF armadillo repeat gene deleted in velocardiofacial syndrome [ Homo sapiens ] |
| Official Symbol | ARVCF |
| Synonyms | ARVCF; armadillo repeat gene deleted in velocardiofacial syndrome; armadillo repeat protein deleted in velo-cardio-facial syndrome; FLJ35345; |
| Gene ID | 421 |
| mRNA Refseq | NM_001670 |
| Protein Refseq | NP_001661 |
| MIM | 602269 |
| UniProt ID | O00192 |
| ◆ Recombinant Proteins | ||
| ARVCF-301126H | Recombinant Human ARVCF protein, GST-tagged | +Inquiry |
| ARVCF-875H | Recombinant Human ARVCF protein, GST-tagged | +Inquiry |
| ARVCF-6035C | Recombinant Chicken ARVCF | +Inquiry |
| Arvcf-3633M | Recombinant Mouse Arvcf, His-tagged | +Inquiry |
| ARVCF-3632H | Recombinant Human ARVCF, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARVCF Products
Required fields are marked with *
My Review for All ARVCF Products
Required fields are marked with *
