Recombinant Human AS3MT protein, GST-tagged

Cat.No. : AS3MT-877H
Product Overview : Human AS3MT full-length ORF ( AAI60057.1, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]).[supplied by OMIM, Mar 2008]
Molecular Mass : 67.65 kDa
AA Sequence : MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLGEAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLAEESDSMKSRCVPDAAGGCCGTKKSC
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AS3MT arsenic (+3 oxidation state) methyltransferase [ Homo sapiens ]
Official Symbol AS3MT
Synonyms AS3MT; arsenic (+3 oxidation state) methyltransferase; arsenite methyltransferase; CYT19; methyltransferase cyt19; methylarsonite methyltransferase; S-adenosylmethionine:arsenic (III) methyltransferase; S-adenosyl-L-methionine:arsenic(III) methyltransferase; RP11-753C18.6;
Gene ID 57412
mRNA Refseq NM_020682
Protein Refseq NP_065733
MIM 611806
UniProt ID Q9HBK9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AS3MT Products

Required fields are marked with *

My Review for All AS3MT Products

Required fields are marked with *

0
cart-icon