Recombinant Human AS3MT protein, GST-tagged
| Cat.No. : | AS3MT-3702H |
| Product Overview : | Recombinant Human AS3MT protein(1-100 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-100 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTG |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | AS3MT arsenic (+3 oxidation state) methyltransferase [ Homo sapiens ] |
| Official Symbol | AS3MT |
| Synonyms | AS3MT; arsenic (+3 oxidation state) methyltransferase; arsenite methyltransferase; CYT19; methyltransferase cyt19; methylarsonite methyltransferase; S-adenosylmethionine:arsenic (III) methyltransferase; S-adenosyl-L-methionine:arsenic(III) methyltransferase; RP11-753C18.6; |
| Gene ID | 57412 |
| mRNA Refseq | NM_020682 |
| Protein Refseq | NP_065733 |
| MIM | 611806 |
| UniProt ID | Q9HBK9 |
| ◆ Recombinant Proteins | ||
| AS3MT-770M | Recombinant Mouse AS3MT Protein, His (Fc)-Avi-tagged | +Inquiry |
| AS3MT-2688H | Recombinant Human AS3MT protein, His-tagged | +Inquiry |
| AS3MT-6784H | Recombinant Human Arsenic (+3 oxidation state) Methyltransferase, His-tagged | +Inquiry |
| AS3MT-877H | Recombinant Human AS3MT protein, GST-tagged | +Inquiry |
| AS3MT-3702H | Recombinant Human AS3MT protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AS3MT Products
Required fields are marked with *
My Review for All AS3MT Products
Required fields are marked with *



