Recombinant Human ASAP1 protein, GST-tagged
Cat.No. : | ASAP1-881H |
Product Overview : | Human ASAP1 full-length ORF ( ADR82673.1, 1 a.a. - 36 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an ADP-ribosylation factor (ARF) GTPase-activating protein. The GTPase-activating activity is stimulated by phosphatidylinositol 4,5-biphosphate (PIP2), and is greater towards ARF1 and ARF5, and lesser for ARF6. This gene maybe involved in regulation of membrane trafficking and cytoskeleton remodeling. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Molecular Mass : | 4 kDa |
AA Sequence : | MNAHLSDVLKHPLHPFFIIFLVLFLDKFKLLKDYSR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASAP1 ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 [ Homo sapiens ] |
Official Symbol | ASAP1 |
Synonyms | ASAP1; ArfGAP with SH3 domain, ankyrin repeat and PH domain 1; DDEF1, development and differentiation enhancing factor 1; arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1; centaurin; beta 4; CENTB4; KIAA1249; PAP; ZG14P; DEF-1; centaurin, beta 4; PIP2-dependent ARF1 GAP; ARF GTPase-activating protein 1; development and differentiation-enhancing factor 1; ADP-ribosylation factor-directed GTPase-activating protein 1; 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein; 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein; PAG2; AMAP1; DDEF1; |
Gene ID | 50807 |
mRNA Refseq | NM_001247996 |
Protein Refseq | NP_001234925 |
MIM | 605953 |
UniProt ID | Q9ULH1 |
◆ Recombinant Proteins | ||
ASAP1-2002M | Recombinant Mouse ASAP1 Protein | +Inquiry |
ASAP1-472R | Recombinant Rat ASAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASAP1-881H | Recombinant Human ASAP1 protein, GST-tagged | +Inquiry |
ASAP1-1259HF | Recombinant Full Length Human ASAP1 Protein, GST-tagged | +Inquiry |
ASAP1-772M | Recombinant Mouse ASAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASAP1-8668HCL | Recombinant Human ASAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASAP1 Products
Required fields are marked with *
My Review for All ASAP1 Products
Required fields are marked with *
0
Inquiry Basket