Recombinant Human ASAP1 protein, GST-tagged

Cat.No. : ASAP1-881H
Product Overview : Human ASAP1 full-length ORF ( ADR82673.1, 1 a.a. - 36 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an ADP-ribosylation factor (ARF) GTPase-activating protein. The GTPase-activating activity is stimulated by phosphatidylinositol 4,5-biphosphate (PIP2), and is greater towards ARF1 and ARF5, and lesser for ARF6. This gene maybe involved in regulation of membrane trafficking and cytoskeleton remodeling. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Molecular Mass : 4 kDa
AA Sequence : MNAHLSDVLKHPLHPFFIIFLVLFLDKFKLLKDYSR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASAP1 ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 [ Homo sapiens ]
Official Symbol ASAP1
Synonyms ASAP1; ArfGAP with SH3 domain, ankyrin repeat and PH domain 1; DDEF1, development and differentiation enhancing factor 1; arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1; centaurin; beta 4; CENTB4; KIAA1249; PAP; ZG14P; DEF-1; centaurin, beta 4; PIP2-dependent ARF1 GAP; ARF GTPase-activating protein 1; development and differentiation-enhancing factor 1; ADP-ribosylation factor-directed GTPase-activating protein 1; 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein; 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein; PAG2; AMAP1; DDEF1;
Gene ID 50807
mRNA Refseq NM_001247996
Protein Refseq NP_001234925
MIM 605953
UniProt ID Q9ULH1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASAP1 Products

Required fields are marked with *

My Review for All ASAP1 Products

Required fields are marked with *

0
cart-icon