Recombinant Human ASB11 protein, GST-tagged

Cat.No. : ASB11-884H
Product Overview : Human ASB11 full-length ORF ( NP_543149.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Molecular Mass : 61.8 kDa
AA Sequence : MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGISDCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLENGAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECMEILLANNVNIDHEVPQLGTPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASB11 ankyrin repeat and SOCS box containing 11 [ Homo sapiens ]
Official Symbol ASB11
Synonyms ASB11; ankyrin repeat and SOCS box containing 11; ankyrin repeat and SOCS box protein 11; DKFZp779E2460; ASB-11; ankyrin repeat domain-containing SOCS box protein ASB11; MGC119168; MGC119169;
Gene ID 140456
mRNA Refseq NM_001012428
Protein Refseq NP_001012428
MIM 300626
UniProt ID Q8WXH4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASB11 Products

Required fields are marked with *

My Review for All ASB11 Products

Required fields are marked with *

0
cart-icon