Recombinant Human ASCL1
Cat.No. : | ASCL1-28522TH |
Product Overview : | Recombinant fragment corresponding to amino acids 137-236 of Human MASH1/Achaete-scute homolog 1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5-CANNTG-3). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
Gene Name | ASCL1 achaete-scute complex homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | ASCL1 |
Synonyms | ASCL1; achaete-scute complex homolog 1 (Drosophila); achaete scute complex (Drosophila) homolog like 1 , achaete scute complex like 1 (Drosophila); achaete-scute homolog 1; ASH1; bHLHa46; HASH1; |
Gene ID | 429 |
mRNA Refseq | NM_004316 |
Protein Refseq | NP_004307 |
MIM | 100790 |
Uniprot ID | P50553 |
Chromosome Location | 12q22-q23 |
Pathway | Delta-Notch Signaling Pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem; |
Function | DNA binding; E-box binding; bHLH transcription factor binding; double-stranded DNA binding; protein binding; |
◆ Recombinant Proteins | ||
ASCL1-1999H | Recombinant Human ASCL1 protein, His-tagged | +Inquiry |
ASCL1-131H | Recombinant Human ASCL1 protein, Arginine-tagged | +Inquiry |
ASCL1-28522TH | Recombinant Human ASCL1 | +Inquiry |
ASCL1-1021HF | Recombinant Full Length Human ASCL1 Protein, GST-tagged | +Inquiry |
ASCL1-5982C | Recombinant Chicken ASCL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASCL1-8654HCL | Recombinant Human ASCL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASCL1 Products
Required fields are marked with *
My Review for All ASCL1 Products
Required fields are marked with *