Recombinant Human ASCL2 Protein, His tagged
| Cat.No. : | ASCL2-001H |
| Product Overview : | Recombinant Human ASCL2 Protein with His tag was expressed in Insect Cells |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 1-193 aa |
| Description : | This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. |
| Form : | Sterile PBS, pH7.4, 10% Glycerol |
| Molecular Mass : | 21 kDa |
| AASequence : | MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGYHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/mL by Bradford |
| Gene Name | ASCL2 achaete-scute family bHLH transcription factor 2 [ Homo sapiens (human) ] |
| Official Symbol | ASCL2 |
| Synonyms | ASCL2; achaete-scute complex homolog 2 (Drosophila); achaete scute complex (Drosophila) homolog like 2, achaete scute complex like 2 (Drosophila); achaete-scute homolog 2; ASH2; bHLHa45; HASH2; ASH-2; achaete-scute complex-like 2; mammalian achaete/scute homologue 2; class A basic helix-loop-helix protein 45; MASH2; |
| Gene ID | 430 |
| mRNA Refseq | NM_005170 |
| Protein Refseq | NP_005161 |
| MIM | 601886 |
| UniProt ID | Q99929 |
| ◆ Recombinant Proteins | ||
| Ascl2-1740M | Recombinant Mouse Ascl2 Protein, Myc/DDK-tagged | +Inquiry |
| ASCL2-001H | Recombinant Human ASCL2 Protein, His tagged | +Inquiry |
| Ascl2-3065M | Recombinant Mouse Ascl2, His-tagged | +Inquiry |
| ASCL2-475R | Recombinant Rat ASCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ASCL2-906H | Recombinant Human SILV protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASCL2 Products
Required fields are marked with *
My Review for All ASCL2 Products
Required fields are marked with *
