Recombinant Human ASCL2 Protein, His tagged

• Cat.No.: ASCL2-001H
• Product Overview: Recombinant Human ASCL2 Protein with His tag was expressed in Insect Cells

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 1-193 aa
• Description: This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.
• Form: Sterile PBS, pH7.4, 10% Glycerol
• Molecular Mass: 21 kDa
• AASequence: MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGYHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by Bradford

Gene Information

• Gene Name: ASCL2 achaete-scute family bHLH transcription factor 2 [ Homo sapiens (human) ]
• Official Symbol: ASCL2
• Synonyms: ASCL2; achaete-scute complex homolog 2 (Drosophila); achaete scute complex (Drosophila) homolog like 2, achaete scute complex like 2 (Drosophila); achaete-scute homolog 2; ASH2; bHLHa45; HASH2; ASH-2; achaete-scute complex-like 2; mammalian achaete/scute homologue 2; class A basic helix-loop-helix protein 45; MASH2
• Gene ID: 430
• mRNA Refseq: NM_005170
• Protein Refseq: NP_005161
• MIM: 601886
• UniProt ID: Q99929