Recombinant Human ASCL2 Protein, His tagged

Cat.No. : ASCL2-001H
Product Overview : Recombinant Human ASCL2 Protein with His tag was expressed in Insect Cells
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 1-193 aa
Description : This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.
Form : Sterile PBS, pH7.4, 10% Glycerol
Molecular Mass : 21 kDa
AASequence : MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGYHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/mL by Bradford
Gene Name ASCL2 achaete-scute family bHLH transcription factor 2 [ Homo sapiens (human) ]
Official Symbol ASCL2
Synonyms ASCL2; achaete-scute complex homolog 2 (Drosophila); achaete scute complex (Drosophila) homolog like 2, achaete scute complex like 2 (Drosophila); achaete-scute homolog 2; ASH2; bHLHa45; HASH2; ASH-2; achaete-scute complex-like 2; mammalian achaete/scute homologue 2; class A basic helix-loop-helix protein 45; MASH2;
Gene ID 430
mRNA Refseq NM_005170
Protein Refseq NP_005161
MIM 601886
UniProt ID Q99929

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASCL2 Products

Required fields are marked with *

My Review for All ASCL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon