Recombinant Human ASCL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ASCL3-3306H |
| Product Overview : | ASCL3 MS Standard C13 and N15-labeled recombinant protein (NP_065697) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues. |
| Molecular Mass : | 20.7 kDa |
| AA Sequence : | MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ASCL3 achaete-scute family bHLH transcription factor 3 [ Homo sapiens (human) ] |
| Official Symbol | ASCL3 |
| Synonyms | ASCL3; achaete-scute complex homolog 3 (Drosophila); achaete scute complex (Drosophila) homolog like 3; achaete-scute homolog 3; bHLHa42; HASH3; Sgn1; ASH-3; bHLH transcriptional regulator Sgn-1; class A basic helix-loop-helix protein 42; bHLH transcription factor Sgn-1 (Salivary Glands 1); SGN1; |
| Gene ID | 56676 |
| mRNA Refseq | NM_020646 |
| Protein Refseq | NP_065697 |
| MIM | 609154 |
| UniProt ID | Q9NQ33 |
| ◆ Recombinant Proteins | ||
| ASCL3-902H | Recombinant Human ASCL3 protein, GST-tagged | +Inquiry |
| ASCL3-2818H | Recombinant Human ASCL3 Protein, MYC/DDK-tagged | +Inquiry |
| ASCL3-786M | Recombinant Mouse ASCL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ASCL3-3306H | Recombinant Human ASCL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ASCL3-1249HF | Recombinant Full Length Human ASCL3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASCL3 Products
Required fields are marked with *
My Review for All ASCL3 Products
Required fields are marked with *
