Recombinant Human ASCL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ASCL3-3306H
Product Overview : ASCL3 MS Standard C13 and N15-labeled recombinant protein (NP_065697) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues.
Molecular Mass : 20.7 kDa
AA Sequence : MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ASCL3 achaete-scute family bHLH transcription factor 3 [ Homo sapiens (human) ]
Official Symbol ASCL3
Synonyms ASCL3; achaete-scute complex homolog 3 (Drosophila); achaete scute complex (Drosophila) homolog like 3; achaete-scute homolog 3; bHLHa42; HASH3; Sgn1; ASH-3; bHLH transcriptional regulator Sgn-1; class A basic helix-loop-helix protein 42; bHLH transcription factor Sgn-1 (Salivary Glands 1); SGN1;
Gene ID 56676
mRNA Refseq NM_020646
Protein Refseq NP_065697
MIM 609154
UniProt ID Q9NQ33

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASCL3 Products

Required fields are marked with *

My Review for All ASCL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon