Recombinant Human ASH2L protein, GST-tagged
Cat.No. : | ASH2L-906H |
Product Overview : | Human ASH2L full-length ORF ( AAH15936.1, 1 a.a. - 534 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ASH2L (ASH2 Like Histone Lysine Methyltransferase Complex Subunit) is a Protein Coding gene. Diseases associated with ASH2L include Kabuki Syndrome 1. Among its related pathways are Signaling by Wnt and Chromatin organization. GO annotations related to this gene include transcription regulatory region DNA binding and histone methyltransferase activity (H3-K4 specific). |
Molecular Mass : | 86.6 kDa |
AA Sequence : | MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASH2L ash2 (absent, small, or homeotic)-like (Drosophila) [ Homo sapiens ] |
Official Symbol | ASH2L |
Synonyms | ASH2L; ash2 (absent, small, or homeotic)-like (Drosophila); ash2 (absent, small, or homeotic, Drosophila, homolog) like , ASH2L1; set1/Ash2 histone methyltransferase complex subunit ASH2; ASH2; ASH2L2; Bre2; ASH2-like protein; ASH2L1; |
Gene ID | 9070 |
mRNA Refseq | NM_001105214 |
Protein Refseq | NP_001098684 |
MIM | 604782 |
UniProt ID | Q9UBL3 |
◆ Recombinant Proteins | ||
ASH2L-25HFL | Recombinant Human ASH2L Protein, Full Length, N-GST tagged | +Inquiry |
ASH2L-159H | Recombinant Human ASH2L Protein, SUMO-tagged | +Inquiry |
ASH2L-009H | Active Recombinant Human ASH2L Protein, SUMO-tagged | +Inquiry |
ASH2L-3046C | Recombinant Chicken ASH2L | +Inquiry |
ASH2L-1087HF | Recombinant Full Length Human ASH2L Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASH2L-8652HCL | Recombinant Human ASH2L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASH2L Products
Required fields are marked with *
My Review for All ASH2L Products
Required fields are marked with *