Recombinant Human ASH2L protein, GST-tagged

Cat.No. : ASH2L-906H
Product Overview : Human ASH2L full-length ORF ( AAH15936.1, 1 a.a. - 534 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ASH2L (ASH2 Like Histone Lysine Methyltransferase Complex Subunit) is a Protein Coding gene. Diseases associated with ASH2L include Kabuki Syndrome 1. Among its related pathways are Signaling by Wnt and Chromatin organization. GO annotations related to this gene include transcription regulatory region DNA binding and histone methyltransferase activity (H3-K4 specific).
Molecular Mass : 86.6 kDa
AA Sequence : MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASH2L ash2 (absent, small, or homeotic)-like (Drosophila) [ Homo sapiens ]
Official Symbol ASH2L
Synonyms ASH2L; ash2 (absent, small, or homeotic)-like (Drosophila); ash2 (absent, small, or homeotic, Drosophila, homolog) like , ASH2L1; set1/Ash2 histone methyltransferase complex subunit ASH2; ASH2; ASH2L2; Bre2; ASH2-like protein; ASH2L1;
Gene ID 9070
mRNA Refseq NM_001105214
Protein Refseq NP_001098684
MIM 604782
UniProt ID Q9UBL3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASH2L Products

Required fields are marked with *

My Review for All ASH2L Products

Required fields are marked with *

0
cart-icon