Recombinant Human ASTN1 protein, His-tagged
| Cat.No. : | ASTN1-4560H |
| Product Overview : | Recombinant Human ASTN1 protein(O14525)(22-153 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 22-153 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 21.8 kDa |
| AASequence : | TAAGDVDPSKELECKLKSITVSALPFLRENDLSIMHSPSASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLFHIHHQDGAPSLPGQDPTEEPQHESAEEELRILH |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | ASTN1 astrotactin 1 [ Homo sapiens ] |
| Official Symbol | ASTN1 |
| Synonyms | ASTN; Astrotactin 1; ASTROTACTIN; ASTN1; KIAA0289 |
| Gene ID | 460 |
| mRNA Refseq | NM_004319.1 |
| Protein Refseq | NP_004310.1 |
| MIM | 600904 |
| UniProt ID | O14525 |
| ◆ Recombinant Proteins | ||
| ASTN1-804M | Recombinant Mouse ASTN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ASTN1-9940H | Recombinant Human ASTN1, His-tagged | +Inquiry |
| ASTN1-9948H | Recombinant Human ASTN1, His-tagged | +Inquiry |
| ASTN1-9949H | Recombinant Human ASTN1, GST-tagged | +Inquiry |
| ASTN1-262R | Recombinant Rhesus Macaque ASTN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASTN1 Products
Required fields are marked with *
My Review for All ASTN1 Products
Required fields are marked with *
