Recombinant Human ASTN1 protein, His-tagged

• Cat.No.: ASTN1-4560H
• Product Overview: Recombinant Human ASTN1 protein(O14525)(22-153 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 22-153 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 21.8 kDa
• AASequence: TAAGDVDPSKELECKLKSITVSALPFLRENDLSIMHSPSASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLFHIHHQDGAPSLPGQDPTEEPQHESAEEELRILH
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: ASTN1 astrotactin 1 [ Homo sapiens ]
• Official Symbol: ASTN1
• Synonyms: ASTN; Astrotactin 1; ASTROTACTIN; ASTN1; KIAA0289
• Gene ID: 460
• mRNA Refseq: NM_004319.1
• Protein Refseq: NP_004310.1
• MIM: 600904
• UniProt ID: O14525