Recombinant Human ASTN1 protein, His-tagged
Cat.No. : | ASTN1-4560H |
Product Overview : | Recombinant Human ASTN1 protein(O14525)(22-153 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-153 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 21.8 kDa |
AASequence : | TAAGDVDPSKELECKLKSITVSALPFLRENDLSIMHSPSASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLFHIHHQDGAPSLPGQDPTEEPQHESAEEELRILH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | ASTN1 astrotactin 1 [ Homo sapiens ] |
Official Symbol | ASTN1 |
Synonyms | ASTN; Astrotactin 1; ASTROTACTIN; ASTN1; KIAA0289 |
Gene ID | 460 |
mRNA Refseq | NM_004319.1 |
Protein Refseq | NP_004310.1 |
MIM | 600904 |
UniProt ID | O14525 |
◆ Recombinant Proteins | ||
ASTN1-9949H | Recombinant Human ASTN1, GST-tagged | +Inquiry |
ASTN1-2050M | Recombinant Mouse ASTN1 Protein | +Inquiry |
ASTN1-804M | Recombinant Mouse ASTN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASTN1-9940H | Recombinant Human ASTN1, His-tagged | +Inquiry |
ASTN1-3674H | Recombinant Human ASTN1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASTN1 Products
Required fields are marked with *
My Review for All ASTN1 Products
Required fields are marked with *