Recombinant Human ATF3 protein, GST-tagged
Cat.No. : | ATF3-938H |
Product Overview : | Human ATF3 full-length ORF ( AAH06322, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. This gene is induced by a variety of signals, including many of those encountered by cancer cells, and is involved in the complex process of cellular stress response. Multiple transcript variants encoding different isoforms have been found for this gene. It is possible that alternative splicing of this gene may be physiologically important in the regulation of target genes. [provided by RefSeq, Apr 2011] |
Molecular Mass : | 45.65 kDa |
AA Sequence : | MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATF3 activating transcription factor 3 [ Homo sapiens ] |
Official Symbol | ATF3 |
Synonyms | ATF3; activating transcription factor 3; cyclic AMP-dependent transcription factor ATF-3; cAMP-dependent transcription factor ATF-3; FLJ41705; |
Gene ID | 467 |
mRNA Refseq | NM_001030287 |
Protein Refseq | NP_001025458 |
MIM | 603148 |
UniProt ID | P18847 |
◆ Recombinant Proteins | ||
ATF3-065H | Recombinant Human ATF3 Protein, GST-tagged | +Inquiry |
ATF3-066H | Recombinant Human ATF3 Protein, HIS-tagged | +Inquiry |
ATF3-495R | Recombinant Rat ATF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATF3-525H | Recombinant Human ATF3 Protein, His/GST-tagged | +Inquiry |
ATF3-0525H | Recombinant Human ATF3 Protein (Met1-Ser181), N-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATF3-8631HCL | Recombinant Human ATF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATF3 Products
Required fields are marked with *
My Review for All ATF3 Products
Required fields are marked with *
0
Inquiry Basket