Recombinant Human ATF3 protein, GST-tagged

Cat.No. : ATF3-938H
Product Overview : Human ATF3 full-length ORF ( AAH06322, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. This gene is induced by a variety of signals, including many of those encountered by cancer cells, and is involved in the complex process of cellular stress response. Multiple transcript variants encoding different isoforms have been found for this gene. It is possible that alternative splicing of this gene may be physiologically important in the regulation of target genes. [provided by RefSeq, Apr 2011]
Molecular Mass : 45.65 kDa
AA Sequence : MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATF3 activating transcription factor 3 [ Homo sapiens ]
Official Symbol ATF3
Synonyms ATF3; activating transcription factor 3; cyclic AMP-dependent transcription factor ATF-3; cAMP-dependent transcription factor ATF-3; FLJ41705;
Gene ID 467
mRNA Refseq NM_001030287
Protein Refseq NP_001025458
MIM 603148
UniProt ID P18847

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATF3 Products

Required fields are marked with *

My Review for All ATF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon