Recombinant Human ATF3 protein, His-tagged
Cat.No. : | ATF3-6755H |
Product Overview : | Recombinant Human ATF3 protein(1-100 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-100 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ATF3 activating transcription factor 3 [ Homo sapiens ] |
Official Symbol | ATF3 |
Synonyms | ATF3; activating transcription factor 3; cyclic AMP-dependent transcription factor ATF-3; cAMP-dependent transcription factor ATF-3; FLJ41705; |
Gene ID | 467 |
mRNA Refseq | NM_001030287 |
Protein Refseq | NP_001025458 |
MIM | 603148 |
UniProt ID | P18847 |
◆ Recombinant Proteins | ||
ATF3-0525H | Recombinant Human ATF3 Protein (Met1-Ser181), N-GST-tagged | +Inquiry |
ATF3-11199Z | Recombinant Zebrafish ATF3 | +Inquiry |
ATF3-839R | Recombinant Rat ATF3 Protein | +Inquiry |
Atf3-526M | Recombinant Mouse Atf3 Protein, His/GST-tagged | +Inquiry |
ATF3-065H | Recombinant Human ATF3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATF3-8631HCL | Recombinant Human ATF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATF3 Products
Required fields are marked with *
My Review for All ATF3 Products
Required fields are marked with *
0
Inquiry Basket