Recombinant Human ATF6 protein, GST-tagged
| Cat.No. : | ATF6-3759H |
| Product Overview : | Recombinant Human ATF6 protein(81-194 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 23, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 81-194 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | CTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ATF6 activating transcription factor 6 [ Homo sapiens ] |
| Official Symbol | ATF6 |
| Synonyms | ATF6; activating transcription factor 6; cyclic AMP-dependent transcription factor ATF-6 alpha; activating transcription factor 6 alpha; ATF6A; cAMP-dependent transcription factor ATF-6 alpha; FLJ21663; DKFZp686P2194; |
| Gene ID | 22926 |
| mRNA Refseq | NM_007348 |
| Protein Refseq | NP_031374 |
| MIM | 605537 |
| UniProt ID | P18850 |
| ◆ Recombinant Proteins | ||
| ATF6-6204Z | Recombinant Zebrafish ATF6 | +Inquiry |
| ATF6-26190TH | Recombinant Human ATF6, His-tagged | +Inquiry |
| ATF6-3759H | Recombinant Human ATF6 protein, GST-tagged | +Inquiry |
| ATF6-191H | Recombinant Human activating transcription factor 6 Protein, Tag Free | +Inquiry |
| ATF6-841R | Recombinant Rat ATF6 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATF6-144HCL | Recombinant Human ATF6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATF6 Products
Required fields are marked with *
My Review for All ATF6 Products
Required fields are marked with *
