Recombinant Human ATG13 protein, GST-tagged
Cat.No. : | ATG13-944H |
Product Overview : | Human ATG13 full-length ORF ( NP_055556.2, 1 a.a. - 480 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an autophagy factor and a target of the TOR kinase signaling pathway. The encoded protein is essential for autophagosome formation and mitophagy. [provided by RefSeq, Oct 2016] |
Molecular Mass : | 79.2 kDa |
AA Sequence : | METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATG13 ATG13 autophagy related 13 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG13 |
Synonyms | ATG13; ATG13 autophagy related 13 homolog (S. cerevisiae); KIAA0652; autophagy-related protein 13; FLJ20698; |
Gene ID | 9776 |
mRNA Refseq | NM_001142673 |
Protein Refseq | NP_001136145 |
UniProt ID | O75143 |
◆ Recombinant Proteins | ||
ATG13-12H | Recombinant Human ATG13 protein, His-tagged | +Inquiry |
ATG13-821M | Recombinant Mouse ATG13 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATG13-1145HF | Recombinant Full Length Human ATG13 Protein, GST-tagged | +Inquiry |
ATG13-10741Z | Recombinant Zebrafish ATG13 | +Inquiry |
ATG13-944H | Recombinant Human ATG13 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG13-4970HCL | Recombinant Human KIAA0652 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG13 Products
Required fields are marked with *
My Review for All ATG13 Products
Required fields are marked with *
0
Inquiry Basket