Recombinant Human ATG16L1 protein, GST-tagged
Cat.No. : | ATG16L1-945H |
Product Overview : | Human ATG16L1 full-length ORF ( NP_110430.4, 1 a.a. - 523 a.a.) recombinant protein with GST-tag at N-terminal. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2010] |
Molecular Mass : | 84.7 kDa |
AA Sequence : | MAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Publications : |
The autophagy protein ATG16L1 cooperates with IFT20 and INPP5E to regulate the turnover of phosphoinositides at the primary cilium (2021)
|
Gene Name | ATG16L1 ATG16 autophagy related 16-like 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG16L1 |
Synonyms | ATG16L1; ATG16 autophagy related 16-like 1 (S. cerevisiae); APG16 autophagy 16 like (S. cerevisiae) , APG16L, ATG16 autophagy related 16 like (S. cerevisiae) , ATG16L; autophagy-related protein 16-1; ATG16A; FLJ10035; WDR30; APG16L beta; WD repeat domain 30; IBD10; APG16L; ATG16L; FLJ00045; FLJ10828; FLJ22677; |
Gene ID | 55054 |
mRNA Refseq | NM_001190266 |
Protein Refseq | NP_001177195 |
MIM | 610767 |
UniProt ID | Q676U5 |
◆ Recombinant Proteins | ||
ATG16L1-259H | Recombinant Human ATG16L1 Protein, His-tagged | +Inquiry |
ATG16L1-5787H | Recombinant Human ATG16L1 protein, His-tagged | +Inquiry |
ATG16L1-1215HF | Recombinant Full Length Human ATG16L1 Protein, GST-tagged | +Inquiry |
ATG16L1-2947H | Recombinant Human ATG16L1 Protein, His-tagged | +Inquiry |
ATG16L1-439R | Recombinant Rhesus monkey ATG16L1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG16L1-146HCL | Recombinant Human ATG16L1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG16L1 Products
Required fields are marked with *
My Review for All ATG16L1 Products
Required fields are marked with *