Recombinant Human ATG16L1 protein, His-SUMO-tagged
| Cat.No. : | ATG16L1-4540H |
| Product Overview : | Recombinant Human ATG16L1 protein(Q676U5)(1-607aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-607aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 84.3 kDa |
| AA Sequence : | MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ATG16L1 ATG16 autophagy related 16-like 1 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ATG16L1 |
| Synonyms | ATG16L1; ATG16 autophagy related 16-like 1 (S. cerevisiae); APG16 autophagy 16 like (S. cerevisiae) , APG16L, ATG16 autophagy related 16 like (S. cerevisiae) , ATG16L; autophagy-related protein 16-1; ATG16A; FLJ10035; WDR30; APG16L beta; WD repeat domain 30; IBD10; APG16L; ATG16L; FLJ00045; FLJ10828; FLJ22677; |
| Gene ID | 55054 |
| mRNA Refseq | NM_001190266 |
| Protein Refseq | NP_001177195 |
| MIM | 610767 |
| UniProt ID | Q676U5 |
| ◆ Recombinant Proteins | ||
| ATG16L1-1215HF | Recombinant Full Length Human ATG16L1 Protein, GST-tagged | +Inquiry |
| ATG16L1-1469H | Recombinant Human ATG16L1 protein, His & GST-tagged | +Inquiry |
| ATG16L1-1470H | Recombinant Human ATG16L1 protein, His & T7-tagged | +Inquiry |
| ATG16L1-0385H | Recombinant Human ATG16L1 Protein (Met85-Gly284), N-GST-tagged | +Inquiry |
| ATG16L1-268R | Recombinant Rhesus Macaque ATG16L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATG16L1-001HKCL | Human ATG16L1 Knockdown Cell Lysate | +Inquiry |
| ATG16L1-146HCL | Recombinant Human ATG16L1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG16L1 Products
Required fields are marked with *
My Review for All ATG16L1 Products
Required fields are marked with *
