Recombinant Human ATG16L1 protein, His-SUMO-tagged

Cat.No. : ATG16L1-4540H
Product Overview : Recombinant Human ATG16L1 protein(Q676U5)(1-607aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-607aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 84.3 kDa
AA Sequence : MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ATG16L1 ATG16 autophagy related 16-like 1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG16L1
Synonyms ATG16L1; ATG16 autophagy related 16-like 1 (S. cerevisiae); APG16 autophagy 16 like (S. cerevisiae) , APG16L, ATG16 autophagy related 16 like (S. cerevisiae) , ATG16L; autophagy-related protein 16-1; ATG16A; FLJ10035; WDR30; APG16L beta; WD repeat domain 30; IBD10; APG16L; ATG16L; FLJ00045; FLJ10828; FLJ22677;
Gene ID 55054
mRNA Refseq NM_001190266
Protein Refseq NP_001177195
MIM 610767
UniProt ID Q676U5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG16L1 Products

Required fields are marked with *

My Review for All ATG16L1 Products

Required fields are marked with *

0
cart-icon