Recombinant Human ATG3 protein, GST-tagged

Cat.No. : ATG3-1816H
Product Overview : Recombinant Human ATG3 protein(1-314 aa), fused to GST tag, was expressed in E. coli.
Availability January 07, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-314 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ATG3 ATG3 autophagy related 3 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG3
Synonyms ATG3; ATG3 autophagy related 3 homolog (S. cerevisiae); APG3 autophagy 3 like (S. cerevisiae) , APG3L; ubiquitin-like-conjugating enzyme ATG3; DKFZp564M1178; FLJ22125; MGC15201; PC3 96; hApg3; 2610016C12Rik; autophagy-related protein 3; APG3; APG3L; PC3-96; APG3-LIKE;
Gene ID 64422
mRNA Refseq NM_022488
Protein Refseq NP_071933
MIM 609606
UniProt ID Q9NT62

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG3 Products

Required fields are marked with *

My Review for All ATG3 Products

Required fields are marked with *

0
cart-icon
0
compare icon