Recombinant Human ATG3 protein, GST-tagged
| Cat.No. : | ATG3-1816H |
| Product Overview : | Recombinant Human ATG3 protein(1-314 aa), fused to GST tag, was expressed in E. coli. |
| Availability | May 25, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-314 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ATG3 ATG3 autophagy related 3 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ATG3 |
| Synonyms | ATG3; ATG3 autophagy related 3 homolog (S. cerevisiae); APG3 autophagy 3 like (S. cerevisiae) , APG3L; ubiquitin-like-conjugating enzyme ATG3; DKFZp564M1178; FLJ22125; MGC15201; PC3 96; hApg3; 2610016C12Rik; autophagy-related protein 3; APG3; APG3L; PC3-96; APG3-LIKE; |
| Gene ID | 64422 |
| mRNA Refseq | NM_022488 |
| Protein Refseq | NP_071933 |
| MIM | 609606 |
| UniProt ID | Q9NT62 |
| ◆ Recombinant Proteins | ||
| ATG3-5340C | Recombinant Chicken ATG3 | +Inquiry |
| ATG3-10381Z | Recombinant Zebrafish ATG3 | +Inquiry |
| APG3L-678H | Recombinant Human APG3L protein, GST-tagged | +Inquiry |
| ATG3-3031H | Recombinant Human ATG3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ATG3-440R | Recombinant Rhesus monkey ATG3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATG3-8625HCL | Recombinant Human ATG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG3 Products
Required fields are marked with *
My Review for All ATG3 Products
Required fields are marked with *
