Recombinant Human ATG3 protein, GST-tagged
Cat.No. : | ATG3-1816H |
Product Overview : | Recombinant Human ATG3 protein(1-314 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-314 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ATG3 ATG3 autophagy related 3 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG3 |
Synonyms | ATG3; ATG3 autophagy related 3 homolog (S. cerevisiae); APG3 autophagy 3 like (S. cerevisiae) , APG3L; ubiquitin-like-conjugating enzyme ATG3; DKFZp564M1178; FLJ22125; MGC15201; PC3 96; hApg3; 2610016C12Rik; autophagy-related protein 3; APG3; APG3L; PC3-96; APG3-LIKE; |
Gene ID | 64422 |
mRNA Refseq | NM_022488 |
Protein Refseq | NP_071933 |
MIM | 609606 |
UniProt ID | Q9NT62 |
◆ Recombinant Proteins | ||
ATG3-396H | Recombinant Human ATG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATG3-0070H | Recombinant Human ATG3 Protein (Met1-Met314), N-His-tagged | +Inquiry |
ATG3-825M | Recombinant Mouse ATG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATG3-744H | Active Recombinant Human ATG3 Protein, His-tagged | +Inquiry |
APG3L-678H | Recombinant Human APG3L protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG3-8625HCL | Recombinant Human ATG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG3 Products
Required fields are marked with *
My Review for All ATG3 Products
Required fields are marked with *
0
Inquiry Basket