Recombinant Human APG3L protein, GST-tagged
Cat.No. : | APG3L-678H |
Product Overview : | Human APG3L partial ORF ( NP_071933, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATG3 ATG3 autophagy related 3 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG3 |
Synonyms | ATG3; ATG3 autophagy related 3 homolog (S. cerevisiae); APG3 autophagy 3 like (S. cerevisiae) , APG3L; ubiquitin-like-conjugating enzyme ATG3; DKFZp564M1178; FLJ22125; MGC15201; PC3 96; hApg3; 2610016C12Rik; autophagy-related protein 3; APG3; APG3L; PC3-96; APG3-LIKE; |
Gene ID | 64422 |
mRNA Refseq | NM_022488 |
Protein Refseq | NP_071933 |
MIM | 609606 |
UniProt ID | Q9NT62 |
◆ Recombinant Proteins | ||
ATG3-2564H | Recombinant Human ATG3 protein, His-SUMO-tagged | +Inquiry |
ATG3-0069H | Recombinant Human ATG3 Protein (Met1-His287), N-T8 and C-His-tagged | +Inquiry |
ATG3-440R | Recombinant Rhesus monkey ATG3 Protein, His-tagged | +Inquiry |
ATG3-500R | Recombinant Rat ATG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATG3-3031H | Recombinant Human ATG3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG3-8625HCL | Recombinant Human ATG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG3 Products
Required fields are marked with *
My Review for All ATG3 Products
Required fields are marked with *