Recombinant Human ATG4A protein, GST-tagged
Cat.No. : | ATG4A-948H |
Product Overview : | Human ATG4A full-length ORF ( NP_443168.2, 1 a.a. - 398 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. [provided by RefSeq, Mar 2016] |
Molecular Mass : | 71.8 kDa |
AA Sequence : | MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATG4A ATG4 autophagy related 4 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG4A |
Synonyms | ATG4A; ATG4 autophagy related 4 homolog A (S. cerevisiae); APG4 autophagy 4 homolog A (S. cerevisiae) , APG4A, AUT like 2, cysteine endopeptidase (S. cerevisiae) , AUTL2; cysteine protease ATG4A; hAPG4A; autophagin 2; autophagin-2; APG4 autophagy 4 homolog A; AUT-like 2 cysteine endopeptidase; AUT-like 2, cysteine endopeptidase; autophagy-related protein 4 homolog A; autophagy-related cysteine endopeptidase 2; APG4A; AUTL2; |
Gene ID | 115201 |
mRNA Refseq | NM_052936 |
Protein Refseq | NP_443168 |
MIM | 300663 |
UniProt ID | Q8WYN0 |
◆ Recombinant Proteins | ||
ATG4A-4695C | Recombinant Chicken ATG4A | +Inquiry |
ATG4A-6522H | Recombinant Human ATG4A protein, His-tagged | +Inquiry |
ATG4A-441R | Recombinant Rhesus monkey ATG4A Protein, His-tagged | +Inquiry |
ATG4A-270R | Recombinant Rhesus Macaque ATG4A Protein, His (Fc)-Avi-tagged | +Inquiry |
ATG4A-36H | Recombinant Human ATG4A, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG4A Products
Required fields are marked with *
My Review for All ATG4A Products
Required fields are marked with *
0
Inquiry Basket