Recombinant Human ATG4A protein, GST-tagged

Cat.No. : ATG4A-948H
Product Overview : Human ATG4A full-length ORF ( NP_443168.2, 1 a.a. - 398 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. [provided by RefSeq, Mar 2016]
Molecular Mass : 71.8 kDa
AA Sequence : MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATG4A ATG4 autophagy related 4 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG4A
Synonyms ATG4A; ATG4 autophagy related 4 homolog A (S. cerevisiae); APG4 autophagy 4 homolog A (S. cerevisiae) , APG4A, AUT like 2, cysteine endopeptidase (S. cerevisiae) , AUTL2; cysteine protease ATG4A; hAPG4A; autophagin 2; autophagin-2; APG4 autophagy 4 homolog A; AUT-like 2 cysteine endopeptidase; AUT-like 2, cysteine endopeptidase; autophagy-related protein 4 homolog A; autophagy-related cysteine endopeptidase 2; APG4A; AUTL2;
Gene ID 115201
mRNA Refseq NM_052936
Protein Refseq NP_443168
MIM 300663
UniProt ID Q8WYN0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG4A Products

Required fields are marked with *

My Review for All ATG4A Products

Required fields are marked with *

0
cart-icon