Recombinant Human ATIC protein, GST-tagged
| Cat.No. : | ATIC-952H |
| Product Overview : | Human ATIC full-length ORF ( NP_004035.2, 1 a.a. - 592 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a bifunctional protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-terminal domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-terminal domain has IMP cyclohydrolase activity. A mutation in this gene results in AICA-ribosiduria. [provided by RefSeq, Sep 2009] |
| Molecular Mass : | 91 kDa |
| AA Sequence : | MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATIC 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [ Homo sapiens ] |
| Official Symbol | ATIC |
| Synonyms | ATIC; 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase; bifunctional purine biosynthesis protein PURH; AICARFT; IMPCHASE; phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; PURH; AICARFT/IMPCHASE; AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme; 5-aminoimidazole-4-carboxamide-1-beta-D-ribonucleotide transformylase/inosinicase; AICAR; FLJ93545; |
| Gene ID | 471 |
| mRNA Refseq | NM_004044 |
| Protein Refseq | NP_004035 |
| MIM | 601731 |
| UniProt ID | P31939 |
| ◆ Recombinant Proteins | ||
| ATIC-6733C | Recombinant Chicken ATIC | +Inquiry |
| ATIC-27034TH | Recombinant Human ATIC | +Inquiry |
| ATIC-5208Z | Recombinant Zebrafish ATIC | +Inquiry |
| ATIC-398H | Recombinant Human ATIC Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATIC-831M | Recombinant Mouse ATIC Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATIC-8618HCL | Recombinant Human ATIC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATIC Products
Required fields are marked with *
My Review for All ATIC Products
Required fields are marked with *
