Recombinant Human ATIC Protein, His-tagged
| Cat.No. : | ATIC-26H |
| Product Overview : | Recombinant Human ATIC Protein(P31939)(291-592 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 291-592 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | DLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | ATIC 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [ Homo sapiens ] |
| Official Symbol | ATIC |
| Synonyms | ATIC; 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase; bifunctional purine biosynthesis protein PURH; AICARFT; IMPCHASE; phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; PURH; AICARFT/IMPCHASE; AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme; 5-aminoimidazole-4-carboxamide-1-beta-D-ribonucleotide transformylase/inosinicase; AICAR; FLJ93545; |
| Gene ID | 471 |
| mRNA Refseq | NM_004044 |
| Protein Refseq | NP_004035 |
| MIM | 601731 |
| UniProt ID | P31939 |
| ◆ Recombinant Proteins | ||
| ATIC-6733C | Recombinant Chicken ATIC | +Inquiry |
| ATIC-24H | Recombinant Human ATIC protein, His-tagged | +Inquiry |
| Atic-365M | Recombinant Mouse Atic Protein, MYC/DDK-tagged | +Inquiry |
| ATIC-1075HF | Recombinant Full Length Human ATIC Protein, GST-tagged | +Inquiry |
| ATIC-2090M | Recombinant Mouse ATIC Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATIC-8618HCL | Recombinant Human ATIC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATIC Products
Required fields are marked with *
My Review for All ATIC Products
Required fields are marked with *



