Recombinant Human ATIC Protein, His-tagged

• Cat.No.: ATIC-26H
• Product Overview: Recombinant Human ATIC Protein(P31939)(291-592 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 291-592 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: DLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ATIC 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [ Homo sapiens ]
• Official Symbol: ATIC
• Synonyms: ATIC; 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase; bifunctional purine biosynthesis protein PURH; AICARFT; IMPCHASE; phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; PURH; AICARFT/IMPCHASE; AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme; 5-aminoimidazole-4-carboxamide-1-beta-D-ribonucleotide transformylase/inosinicase; AICAR; FLJ93545
• Gene ID: 471
• mRNA Refseq: NM_004044
• Protein Refseq: NP_004035
• MIM: 601731
• UniProt ID: P31939