Recombinant Human ATP1B1 protein(101-170 aa), C-His-tagged
| Cat.No. : | ATP1B1-2550H |
| Product Overview : | Recombinant Human ATP1B1 protein(P05026)(101-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 101-170 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | YVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYK |
| Gene Name | ATP1B1 ATPase, Na+/K+ transporting, beta 1 polypeptide [ Homo sapiens ] |
| Official Symbol | ATP1B1 |
| Synonyms | ATP1B1; ATPase, Na+/K+ transporting, beta 1 polypeptide; ATP1B; sodium/potassium-transporting ATPase subunit beta-1; adenosinetriphosphatase; Na, K-ATPase beta-1 polypeptide; Beta 1-subunit of Na(+),K(+)-ATPase; sodium/potassium-dependent ATPase beta-1 subunit; sodium/potassium-transporting ATPase beta-1 chain; MGC1798; |
| Gene ID | 481 |
| mRNA Refseq | NM_001677 |
| Protein Refseq | NP_001668 |
| MIM | 182330 |
| UniProt ID | P05026 |
| ◆ Recombinant Proteins | ||
| ATP1B1-1131HF | Recombinant Full Length Human ATP1B1 Protein, GST-tagged | +Inquiry |
| RFL-11841CF | Recombinant Full Length Dog Sodium/Potassium-Transporting Atpase Subunit Beta-1(Atp1B1) Protein, His-Tagged | +Inquiry |
| ATP1B1-246H | Recombinant Human ATP1B1, His tagged | +Inquiry |
| ATP1B1-2116M | Recombinant Mouse ATP1B1 Protein | +Inquiry |
| ATP1B1-512R | Recombinant Rat ATP1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP1B1-919HCL | Recombinant Human ATP1B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP1B1 Products
Required fields are marked with *
My Review for All ATP1B1 Products
Required fields are marked with *
