Recombinant Human ATP1B1 protein(101-170 aa), C-His-tagged

• Cat.No.: ATP1B1-2550H
• Product Overview: Recombinant Human ATP1B1 protein(P05026)(101-170 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 101-170 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: YVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYK

Gene Information

• Gene Name: ATP1B1 ATPase, Na+/K+ transporting, beta 1 polypeptide [ Homo sapiens ]
• Official Symbol: ATP1B1
• Synonyms: ATP1B1; ATPase, Na+/K+ transporting, beta 1 polypeptide; ATP1B; sodium/potassium-transporting ATPase subunit beta-1; adenosinetriphosphatase; Na, K-ATPase beta-1 polypeptide; Beta 1-subunit of Na(+),K(+)-ATPase; sodium/potassium-dependent ATPase beta-1 subunit; sodium/potassium-transporting ATPase beta-1 chain; MGC1798
• Gene ID: 481
• mRNA Refseq: NM_001677
• Protein Refseq: NP_001668
• MIM: 182330
• UniProt ID: P05026