Recombinant Human ATP1B1 protein(101-170 aa), C-His-tagged

Cat.No. : ATP1B1-2550H
Product Overview : Recombinant Human ATP1B1 protein(P05026)(101-170 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 101-170 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : YVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYK
Gene Name ATP1B1 ATPase, Na+/K+ transporting, beta 1 polypeptide [ Homo sapiens ]
Official Symbol ATP1B1
Synonyms ATP1B1; ATPase, Na+/K+ transporting, beta 1 polypeptide; ATP1B; sodium/potassium-transporting ATPase subunit beta-1; adenosinetriphosphatase; Na, K-ATPase beta-1 polypeptide; Beta 1-subunit of Na(+),K(+)-ATPase; sodium/potassium-dependent ATPase beta-1 subunit; sodium/potassium-transporting ATPase beta-1 chain; MGC1798;
Gene ID 481
mRNA Refseq NM_001677
Protein Refseq NP_001668
MIM 182330
UniProt ID P05026

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP1B1 Products

Required fields are marked with *

My Review for All ATP1B1 Products

Required fields are marked with *

0
cart-icon