Recombinant Human ATP1B2 protein, GST-tagged
Cat.No. : | ATP1B2-966H |
Product Overview : | Human ATP1B2 full-length ORF ( NP_001669.3, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014] |
Molecular Mass : | 59.8 kDa |
AA Sequence : | MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP1B2 ATPase, Na+/K+ transporting, beta 2 polypeptide [ Homo sapiens ] |
Official Symbol | ATP1B2 |
Synonyms | ATP1B2; ATPase, Na+/K+ transporting, beta 2 polypeptide; sodium/potassium-transporting ATPase subunit beta-2; AMOG; adhesion molecule on glia; Na, K-ATPase beta-2 polypeptide; sodium/potassium-dependent ATPase beta-2 subunit; sodium/potassium-dependent ATPase subunit beta-2; sodium/potassium-transporting ATPase beta-2 chain; |
Gene ID | 482 |
mRNA Refseq | NM_001678 |
Protein Refseq | NP_001669 |
MIM | 182331 |
UniProt ID | P14415 |
◆ Recombinant Proteins | ||
ATP1B2-129H | Recombinant Human ATP1B2 protein, His-tagged | +Inquiry |
ATP1B2-2069H | Recombinant Human ATP1B2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATP1B2-625H | Recombinant Human ATP1B2 Protein (Asp68-Thr290), His-tagged | +Inquiry |
ATP1B2-851M | Recombinant Mouse ATP1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Atp1b2-663M | Recombinant Mouse Atp1b2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP1B2-47HCL | Recombinant Human ATP1B2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP1B2 Products
Required fields are marked with *
My Review for All ATP1B2 Products
Required fields are marked with *
0
Inquiry Basket