Recombinant Human ATP23 Protein, GST-tagged

• Cat.No.: ATP23-4788H
• Product Overview: Human KUB3 partial ORF ( NP_150592, 152 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is amplified in glioblastomas and interacts with the DNA binding subunit of DNA-dependent protein kinase. This kinase is involved in double-strand break repair (DSB), and higher expression of the encoded protein increases the efficiency of DSB. In addition, comparison to orthologous proteins strongly suggests that this protein is a metalloprotease important in the biosynthesis of mitochondrial ATPase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
• Molecular Mass: 36.19 kDa
• AA Sequence: VRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP23 ATP23 metallopeptidase and ATP synthase assembly factor homolog [ Homo sapiens (human) ]
• Official Symbol: ATP23
• Synonyms: XRCC6BP1; XRCC6 binding protein 1; mitochondrial inner membrane protease ATP23 homolog; Ku70 binding protein 3; KUB3; Ku70-binding protein 3; XRCC6-binding protein 1; MGC134817; MGC134818; ATP23; ATP23 metallopeptidase and ATP synthase assembly factor homolog
• Gene ID: 91419
• mRNA Refseq: NM_033276
• Protein Refseq: NP_150592
• UniProt ID: Q9Y6H3