Recombinant Human ATP2A3 protein, GST-tagged

Cat.No. : ATP2A3-971H
Product Overview : Human ATP2A3 partial ORF ( AAH35729, 501 a.a. - 620 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Molecular Mass : 38.94 kDa
AA Sequence : TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP2A3 ATPase, Ca++ transporting, ubiquitous [ Homo sapiens ]
Official Symbol ATP2A3
Synonyms ATP2A3; ATPase, Ca++ transporting, ubiquitous; sarcoplasmic/endoplasmic reticulum calcium ATPase 3; SERCA3; calcium pump 3; SR Ca(2+)-ATPase 3; adenosine triphosphatase, calcium; calcium-translocating P-type ATPase; ATPase, Ca(2+)-transporting, ubiquitous; sarco/endoplasmic reticulum Ca2+ -ATPase;
Gene ID 489
mRNA Refseq NM_005173
Protein Refseq NP_005164
MIM 601929
UniProt ID Q93084

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP2A3 Products

Required fields are marked with *

My Review for All ATP2A3 Products

Required fields are marked with *

0
cart-icon