"ATP2B1" Related Products

Expand

Recombinant Human ATP2B1 protein, GST-tagged

Cat.No.: ATP2B1-972H
Product Overview: Human ATP2B1 partial ORF ( NP_001673, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.
Description: The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 1. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 36.41 kDa
AA Sequence: MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKT
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: ATP2B1 ATPase, Ca++ transporting, plasma membrane 1 [ Homo sapiens ]
Official Symbol: ATP2B1
Synonyms: ATP2B1; ATPase, Ca++ transporting, plasma membrane 1; plasma membrane calcium-transporting ATPase 1; plasma membrane calcium transporting ATPase 1; PMCA1; plasma membrane calcium pump; PMCA1kb;
Gene ID: 490
mRNA Refseq: NM_001001323
Protein Refseq: NP_001001323
MIM: 108731
UniProt ID: P20020

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.