Recombinant Human ATP5D protein, His-tagged
| Cat.No. : | ATP5D-979H |
| Product Overview : | Human ATP5D (NP_001678, 23 a.a. - 168 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-168 a.a. |
| Description : | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008] |
| Form : | Liquid |
| Molecular Mass : | 17.3 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Concentration : | 0.25 mg/mL |
| Storage Buffer : | In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (20% glycerol) |
| Gene Name | ATP5D ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit [ Homo sapiens ] |
| Official Symbol | ATP5D |
| Synonyms | ATP5D; ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit; ATP synthase subunit delta, mitochondrial; F-ATPase delta subunit; mitochondrial ATP synthase, delta subunit; mitochondrial ATP synthase complex delta-subunit precusor; |
| Gene ID | 513 |
| mRNA Refseq | NM_001001975 |
| Protein Refseq | NP_001001975 |
| MIM | 603150 |
| UniProt ID | P30049 |
| ◆ Recombinant Proteins | ||
| ATP5D-2569H | Recombinant Human ATP5D protein, His-SUMO-tagged | +Inquiry |
| ATP5D-869R | Recombinant Rat ATP5D Protein | +Inquiry |
| ATP5D-454R | Recombinant Rhesus monkey ATP5D Protein, His-tagged | +Inquiry |
| Atp5d-3713R | Recombinant Rat Atp5d, His-tagged | +Inquiry |
| ATP5D-3572H | Recombinant Human ATP5D protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP5D-49HCL | Recombinant Human ATP5D lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5D Products
Required fields are marked with *
My Review for All ATP5D Products
Required fields are marked with *
