Recombinant Human ATP5F1, His-tagged
Cat.No. : | ATP5F1-37H |
Product Overview : | Recombinant Human ATP Synthase Subunit B Mitochondrial/ATP5F1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Pro43-Met256) of Human ATP5F1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 43-256 a.a. |
AA Sequence : | PVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLG VMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRN NIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIA KCIADLKLLAKKAQAQPVMVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | ATP5F1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 [ Homo sapiens ] |
Official Symbol | ATP5F1 |
Synonyms | ATP5F1; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1 , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase subunit b, mitochondrial; ATPase subunit b; H+-ATP synthase subunit b; ATP synthase B chain, mitochondrial; cell proliferation-inducing protein 47; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1; PIG47; MGC24431; |
Gene ID | 515 |
mRNA Refseq | NM_001688 |
Protein Refseq | NP_001679 |
MIM | 603270 |
UniProt ID | P24539 |
Chromosome Location | 1p13.2 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
Function | contributes_to ATPase activity; hydrogen ion transmembrane transporter activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; protein binding; transmembrane transporter activity; |
◆ Recombinant Proteins | ||
ATP5F1-981H | Recombinant Human ATP5F1 protein, GST-tagged | +Inquiry |
ATP5F1-5020H | Recombinant Human ATP5F1, His-tagged | +Inquiry |
ATP5F1-37H | Recombinant Human ATP5F1, His-tagged | +Inquiry |
ATP5F1-10019H | Recombinant Human ATP5F1, His-tagged | +Inquiry |
ATP5F1-1452HF | Recombinant Full Length Human ATP5F1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5F1-8601HCL | Recombinant Human ATP5F1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5F1 Products
Required fields are marked with *
My Review for All ATP5F1 Products
Required fields are marked with *